KEGG   Thermus thermophilus JL-18: TtJL18_0236Help
Entry
TtJL18_0236       CDS       T02009                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TtJL18_0236
Enzymes [BR:ttl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TtJL18_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213109..213936
Genome map
AA seq 275 aa AA seqDB search
MERLAPAKVNLGLSVRFRREDGYHELHTLFAPFSLADRLVVEPVSAGLHFQGPYGRENLA
YRAASLYLEAAGQPGGVRILLEKRIPEGAGLGGGSSDAAQVLLALQALYPAEVDLFALAR
TLGADVPFFLLGQGAEARGVGERLKPLALPPVPAVVFFPGLRVPTPLVYRAVRPEDFGPD
LPVEAILEALARGEEPPYWNSLEGPAFRLFPELKEVRGRMRALGLRGVLMSGSGSAFFGL
AEGPDHARRAAEALRAWGRAWAGTLGGGDAGSGPA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcctagcccccgcgaaggtcaacctcgggctttccgtccgcttccggcgggag
gacggataccacgagctccacaccctcttcgcccccttctccctggcggaccggctggtg
gtggagcccgtttcggcgggcctccacttccaggggccttacgggcgggagaacctggcc
taccgggcggcctccctctacctcgaggcggcgggccaacccgggggcgtgcgcatcctt
ttggagaagcggatccccgagggggccgggctcgggggcgggagttccgacgcggcccag
gtccttctcgccctccaggccctctacccggcggaggtggacctcttcgccctggcccgg
accctcggggcggacgtccccttcttcctcctcgggcagggggcggaggcccgaggggtg
ggggagaggcttaagcccctcgccttgcccccggtccccgcggtggtcttttttcccggg
ctccgggtgcccacgcccttggtctaccgcgccgtgcggccggaggacttcggcccggac
ctccccgtggaggccatcctcgaggccttggcccggggggaggagcccccgtactggaac
agcctggaaggccccgccttccgcctcttccccgagctcaaggaggtgcggggccggatg
cgggctttggggcttaggggggtgctcatgtcgggctcggggagcgccttcttcgggctt
gcggaaggcccggaccacgcgaggcgggcggcggaggcgcttagggcttgggggcgcgcc
tgggccggcacgctgggaggtggggatgctgggtctggacctgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system