KEGG   Thermus thermophilus JL-18: TtJL18_0236Help
Entry
TtJL18_0236       CDS       T02009                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ttl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213109..213936
Genome map
AA seq 275 aa AA seqDB search
MERLAPAKVNLGLSVRFRREDGYHELHTLFAPFSLADRLVVEPVSAGLHFQGPYGRENLA
YRAASLYLEAAGQPGGVRILLEKRIPEGAGLGGGSSDAAQVLLALQALYPAEVDLFALAR
TLGADVPFFLLGQGAEARGVGERLKPLALPPVPAVVFFPGLRVPTPLVYRAVRPEDFGPD
LPVEAILEALARGEEPPYWNSLEGPAFRLFPELKEVRGRMRALGLRGVLMSGSGSAFFGL
AEGPDHARRAAEALRAWGRAWAGTLGGGDAGSGPA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcctagcccccgcgaaggtcaacctcgggctttccgtccgcttccggcgggag
gacggataccacgagctccacaccctcttcgcccccttctccctggcggaccggctggtg
gtggagcccgtttcggcgggcctccacttccaggggccttacgggcgggagaacctggcc
taccgggcggcctccctctacctcgaggcggcgggccaacccgggggcgtgcgcatcctt
ttggagaagcggatccccgagggggccgggctcgggggcgggagttccgacgcggcccag
gtccttctcgccctccaggccctctacccggcggaggtggacctcttcgccctggcccgg
accctcggggcggacgtccccttcttcctcctcgggcagggggcggaggcccgaggggtg
ggggagaggcttaagcccctcgccttgcccccggtccccgcggtggtcttttttcccggg
ctccgggtgcccacgcccttggtctaccgcgccgtgcggccggaggacttcggcccggac
ctccccgtggaggccatcctcgaggccttggcccggggggaggagcccccgtactggaac
agcctggaaggccccgccttccgcctcttccccgagctcaaggaggtgcggggccggatg
cgggctttggggcttaggggggtgctcatgtcgggctcggggagcgccttcttcgggctt
gcggaaggcccggaccacgcgaggcgggcggcggaggcgcttagggcttgggggcgcgcc
tgggccggcacgctgggaggtggggatgctgggtctggacctgcttaa

DBGET integrated database retrieval system