KEGG   Thermus thermophilus JL-18: TtJL18_0445Help
Entry
TtJL18_0445       CDS       T02009                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ttl  Thermus thermophilus JL-18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TtJL18_0445
DNA repair and recombination proteins [BR:ttl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TtJL18_0445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(386801..387385)
Genome map
AA seq 194 aa AA seqDB search
MRYPESLLKLTRALSRLPGIGPKTAQRLALHLAFHKEEAEALAEALEGLKRVQACRECGN
LAEGELCPICQDEDRDRSLLAVVESVADLYALERSGEFRGLYHVLGGALNPLEGIGPKEL
NLEGLFRRLEGVEEVVLATSMTVEGEATALYLAEELKKRGVRVTRPAYGLPVGGSLEYAD
EVTLGRALEGRRPV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacccggaaagcctcctcaagctcacccgggccctctcccgcctccccggcata
ggccccaagacggcccagcgcctggccctccacctcgccttccacaaggaggaggccgag
gccctggcggaggccctggaggggctcaagcgggtccaggcctgccgcgagtgcggcaac
ctggccgagggggagctctgccccatctgccaggacgaggaccgggaccgctccctcctc
gccgtggtggagagcgtggccgacctgtacgccctggagcggagcggggagttccggggc
ctctaccacgtcctgggaggggccttgaaccccctggagggcatcggccccaaggagctc
aacctggagggtctcttccggcggctggaaggcgtggaggaggtggtcctcgccacctcc
atgaccgtggagggggaggccacagccctctacctcgccgaggagctgaagaagcggggg
gtgcgggtgacccggcccgcctacggcctccccgtgggggggagcctggagtacgccgac
gaggtgaccctgggccgggccctggaggggaggcggcccgtctag

DBGET integrated database retrieval system