KEGG   Thermus thermophilus JL-18: TtJL18_0481Help
Entry
TtJL18_0481       CDS       T02009                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00230  Purine metabolism
ttl01100  Metabolic pathways
Module
ttl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TtJL18_0481
Enzymes [BR:ttl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TtJL18_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_33 EFG_II
Motif
Other DBs
NCBI-ProteinID: AFH38389
UniProt: H9ZPX9
Position
423538..424200
Genome map
AA seq 220 aa AA seqDB search
MRGRLFVMTGASGVGKGTVRAKVLERTRLFYSISMTTRPPRPGEVDGVDYYFVDRPTFEA
LVREDGFLEYAEYVGHLYGTPRAPVERALSRGEDVLLEIEVQGALQVKRAVPEAVLIFLL
PPSLSELKRRLVYRGKDSPEKIQKRLEQAEWEIRNAHLFDYVVVNDVLEEAVADFLAILT
AERRRSGRMEEALERALRRDPALEAELDEILRRRYGGTGH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcggggccgccttttcgtgatgaccggggcgagcggggtgggcaagggcacggtgcgg
gcgaaggtgctggagcgcacccggctcttctactccatctccatgaccacccgccccccc
cggccgggggaggtggacggggtggactactacttcgtggaccgccccacctttgaggcc
ctcgtccgcgaggacggcttcttggagtacgcggagtacgtgggccacctctacggcacc
cccagggccccggtggagcgggccttgagccggggggaggacgtcctcttggagattgag
gtccagggggcgctccaggtgaagcgggccgtgcccgaggcggtcctgatcttcctccta
cccccctccctctccgagctgaagcgccgcctggtctaccggggcaaggacagccccgag
aagatccagaagcgcctggagcaggcggagtgggagataaggaacgcccacctctttgac
tacgtggtggtgaacgacgtcctcgaggaggccgtggccgacttcctcgccatcctcacc
gcggagaggcggcggagcgggaggatggaggaggccttggaaagagccttgcggcgcgat
ccggccctcgaggctgagctggacgagatcctaaggaggcggtatggcggaaccgggcat
tga

DBGET integrated database retrieval system