KEGG   Thermus thermophilus JL-18: TtJL18_0592Help
Entry
TtJL18_0592       CDS       T02009                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00020  Citrate cycle (TCA cycle)
ttl00190  Oxidative phosphorylation
ttl00650  Butanoate metabolism
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01200  Carbon metabolism
Module
ttl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ttl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TtJL18_0592
   00650 Butanoate metabolism
    TtJL18_0592
  Energy metabolism
   00190 Oxidative phosphorylation
    TtJL18_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF3220 EcsB
Motif
Other DBs
NCBI-ProteinID: AFH38497
UniProt: H9ZQ87
Position
522417..522812
Genome map
AA seq 131 aa AA seqDB search
MAIKSKRYQEARLEASTNLELYWWVFMRVSGVVLVFLLIGHMWMNAVLVDLNSIDYDYVA
KRLSQTTWKVYDWLILALALLHGGNGLRYVLDDWVRDPMKRFWTKVVVYSLLAFLFFLGS
LSLFNHDFGVN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaagtccaaaaggtaccaggaggcccggctcgaggccagcaccaacctggag
ctctactggtgggtcttcatgcgcgtctccggggtggtgctcgtcttcttgctcatcggc
cacatgtggatgaacgccgtcctcgtggacctcaactccattgactacgactacgtggcc
aagagactttcccagaccacctggaaggtctacgactggctgatcctggccctggcgctc
ctccacggggggaacgggctgcgctacgtgctggacgactgggtgcgggatcccatgaag
cgcttctggaccaaggtggtggtctacagccttttggcctttctcttcttcctggggagc
ctttccctctttaaccacgacttcggggtgaactag

DBGET integrated database retrieval system