KEGG   Thermus thermophilus JL-18: TtJL18_0786Help
Entry
TtJL18_0786       CDS       T02009                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TtJL18_0786
Enzymes [BR:ttl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TtJL18_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
706286..707788
Genome map
AA seq 500 aa AA seqDB search
MELPRAFGLLLHPTSLPGPYGVGVLGQEARDFLRFLKEAGGRYWQVLPLGPTGYGDSPYQ
SFSAFAGNPYLIDLRPLAERGYVRLEDPGFPQGRVDYGLLYAWKWPALKEAFRGFKEKAS
PEEREAFAAFREREAWWLEDYALFMALKGAHGGLPWNRWPLSLRKREEKALREAKSALAE
EVAFHAFTQWLFFRQWGALKAEAEALGIRIIGDMPIFVAEDSAEVWAHPEWFHLDEEGRP
TVVAGVPPDYFSETGQRWGNPLYRWDVLEREGFSFWIRRLEKALELFHLVRVDHFRGFEA
YWEIPASCPTAVEGRWVKAPGEKLFQKIQEVFGEVPVLAEDLGVITPEVEALRDRFGLPG
MKVLQFAFDDGMENPFLPHNYPAHGWVVVYTGTHDNDTTLGWYRTATPHEKAFVARYLAD
WGITFREEEEVPWALMHLGMKSVARLAVYPVQDVLALGSEARMNYPGRPSGNWAWRLLPG
GLSPEHGARLRAMAEATERL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccccgcgcgttcggtctccttctccaccccacgagcctccccggcccctac
ggcgtcggtgtcctgggccaggaggcccgggacttcctccgcttcctcaaggaggcgggg
gggcggtactggcaggtcctccccttgggccccacgggctatggcgactccccctaccag
tccttcagcgccttcgccggaaacccctacctcatagacctgaggcccctcgcggaaagg
ggctacgtgcgcctggaggaccccggcttcccccaaggccgggtggactacggcctcctc
tacgcctggaagtggcccgccctgaaggaggccttccggggcttcaaggaaaaggcctcc
ccggaggagcgggaggccttcgccgccttccgggagagggaggcctggtggctcgaggac
tacgccctcttcatggccctgaagggggcgcacggggggcttccctggaaccggtggccc
ctttccctgcggaagcgggaagagaaggcccttagggaggcgaaaagcgccttggccgag
gaggtggccttccacgccttcacccagtggctcttcttccgccagtggggggccttgaag
gcggaggccgaggcgttgggcatccggatcatcggggacatgcccatcttcgtggccgag
gactccgccgaggtctgggcccaccccgagtggtttcacctggacgaggagggccgcccc
acggtggtggccggggtgccccccgactacttctcggagacgggccagcgctggggcaac
cccctttaccgctgggacgttttggagcgggaggggttctccttctggatccgccgtctg
gagaaggccctggagctcttccacctggtgcgcgtagaccacttccgcggctttgaggcc
tactgggagatccccgcaagctgccccacggcggtggaggggcgctgggtcaaggccccc
ggggagaagctcttccaaaagatccaggaggtttttggcgaggtccccgtccttgccgag
gacctgggggtgatcacccccgaggtggaggccttgcgggaccggttcggccttcccggg
atgaaggtcttgcagttcgcctttgacgacgggatggaaaaccccttcctcccccacaac
taccccgcccacggctgggtggtggtctacaccggcacccacgacaacgacaccaccctg
ggctggtaccgcacggccaccccccacgagaaggccttcgtggcgcggtacctggcggac
tgggggatcaccttccgggaagaggaggaggtgccctgggccctgatgcacctggggatg
aagtccgtggcccggctcgccgtctacccggtgcaggacgtcctggccctgggcagcgag
gcccggatgaactacccgggaaggccctcggggaactgggcctggcggctcctcccgggg
gggctttccccggagcacggggcgaggcttagggccatggccgaggccacggaacggctc
tag

DBGET integrated database retrieval system