KEGG   Thermus thermophilus JL-18: TtJL18_0799Help
Entry
TtJL18_0799       CDS       T02009                                 

Definition
(GenBank) acyl-CoA synthetase/AMP-acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00010  Glycolysis / Gluconeogenesis
ttl00620  Pyruvate metabolism
ttl00640  Propanoate metabolism
ttl00680  Methane metabolism
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_0799
   00620 Pyruvate metabolism
    TtJL18_0799
   00640 Propanoate metabolism
    TtJL18_0799
  Energy metabolism
   00680 Methane metabolism
    TtJL18_0799
Enzymes [BR:ttl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TtJL18_0799
Lipid biosynthesis proteins [BR:ttl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TtJL18_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C IclR ACAS_N HTH_IclR TrmB Rrf2 MarR_2 HemN_C HTH_23 HTH_29
Motif
Other DBs
NCBI-ProteinID: AFH38702
UniProt: H9ZQU2
Position
complement(723106..725643)
Genome map
AA seq 845 aa AA seqDB search
MARKRGLSTVQQALRLLAYLADHPEGVGAKEVARLLGKSLSSAYALLHSLMEEGFVVKEE
GGFRLARQKPVPLEPTPLEEALEELYLRTRERCYLALLTPEGVRLKTRGRQGQLHPLGEA
LPPEWHALALGKVLLAFGDFPLPPLTPKTPYTLTDPLALEEELKRVRASGLAVEMEEYAL
GVSGVAVPLLSPEGRLLGALGVKVPSRRFPFAFGRLARALAEVARVSAQVLPEEEAPTPP
PALPEPGRVERIDPPEALRRAANLPDPRAAHRASLEDPEAFWEGFARGFAWERPWKAVFR
REDRTWFAGGLTNVALNALDRHLPEKAQQVALLTLDGEGRLGKWTYKEVRELSSRLAGLF
RTLGVGRGDRVALYLPTGLEAALAALACARIGAMHAALPLGLGPEALRRRLEDLRPRLLV
AADAYFYRGQPVRVREVVEAAIQGLDLKVLWHVRGSPEFLERLYEARPAEPEPVPAAHPL
FLLPTSGSTGKPKGVVHGHGGYMVGVAWALRHVFDLKPGEVFHTTADLFWIVGHSFGLYA
PLLLGGTSLLVEDRPDHPSPGAFYERLAHLGVDVLLTSPAVLRTLRRHGEARPTGLRLAA
SVGEVLSPEIWRWTREHLAWPVDNWWQTELGAPALATPPALPAKPGHVGLPLPGVEARVV
DEEGRPLPPGSKGHLVLGATGPAHMVDLQGGRSPWRGGLYWTGDLAEMDEEGYFRILGRT
EEVIKVGEARIGPAEVEAVLLTHPQVAEAAAVGVPGETGEEIAVFVVPQAREFPEELKPL
LAEKLKAHILRHLGPVPPPRVFFRERLPRTRSGKILRRLLKAELLGLDPGDTSGLEEDYG
AGKAP
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaagcgagggctttccaccgtgcagcaggccctgcgccttctggcctacctg
gccgaccacccggaaggggtgggggcgaaggaggtggcccgcctcctggggaagagcctc
tcctccgcctacgccctcctccacagcctgatggaggagggcttcgtggtgaaggaggaa
gggggcttccggctcgcgcggcaaaagcccgtccccttggagcccacgcccttggaggag
gccttggaggaactctacctccgcacccgggagcggtgctacctcgccctcctcacccca
gagggggtgcggctcaagacccgggggcggcagggccagctccaccccctgggggaggcc
ctgcccccggagtggcacgccctggccctgggaaaggtgctcctcgccttcggggacttc
cccctgccccccctcacccccaagaccccctacaccctcaccgaccccctggccctggag
gaggagctgaagcgcgtccgggcctcggggcttgcggtggagatggaggagtacgccctc
ggggtctccggggtggccgtccccctcctgagcccggaggggcgcctcctcggggccctg
ggggtcaaggtgccctcgcgccgcttccccttcgcctttggccgcctggcccgggccctg
gccgaggtggcccgggtctccgcccaggtcctgcccgaggaagaggcccccacccccccg
cccgccctccccgagccgggaagggtggagcggatagaccccccagaggccctccgccgc
gccgccaacctgcccgacccccgggccgcccaccgggcaagcctcgaggaccccgaggcc
ttctgggaaggcttcgcccggggtttcgcctgggagaggccctggaaggcggtcttccgc
cgggaggaccggacctggttcgcgggcggccttaccaacgtggccctaaacgccctggac
cggcacctcccggaaaaggcccagcaggtcgccctcctcaccctggacggagaagggcgg
ctcggcaagtggacctacaaggaggtccgggagctctcaagcaggctcgccgggctcttc
cggaccctcggggtggggcggggggacagggtggccctctacctgcccacgggcctcgag
gccgccctcgccgccttggcctgcgcccggatcggggcgatgcacgcggccctgcccctg
ggcctgggcccggaggccctgaggcggcgcctcgaggacctgaggccccggctcctcgtg
gcggcggacgcctacttctaccggggccagcccgtgcgggtgcgggaggtggtggaggcc
gcaatccagggcctggacctcaaggtcctctggcacgtccggggaagccccgagtttctg
gagcggctttacgaggcccggcccgccgagcccgagcccgtgcccgcggcccaccccctc
ttcctccttcccacctcgggctccacggggaagcccaagggcgtggtccacggccacggg
gggtacatggtgggggtcgcctgggccctccgacacgtctttgacctgaagccgggagag
gtgttccacaccaccgccgacctcttctggatcgtgggccactccttcggcctctacgcc
cccttgcttctcggcggcacctccctcctcgtggaggaccggcccgaccacccgagcccc
ggggccttctacgagcgcctggcccacctcggggtggacgtcctcctcacctcccccgcg
gtgctccggaccctgaggcgccacggggaggcccggcccacgggcctccgcctggcggcg
agcgtgggcgaggtgctgagccccgagatctggcgctggacccgggagcacctggcctgg
cccgtggacaactggtggcagacggagctcggggcccccgccctggccacgccccccgcc
ctcccggccaagcccggccacgtgggcctccccctccccggggtggaggcccgggtggtg
gacgaggaggggcggcccctccctcccgggagcaaggggcacctggtcctcggcgccacg
gggcccgcccacatggtggacctccagggggggcgctccccctggcggggaggcctctac
tggacgggggacctcgcggagatggacgaggaagggtacttccgcatcctgggccgcacc
gaggaggtcatcaaggtgggcgaggcccggatcggccccgcggaggtggaggccgtcctc
ctcacccacccccaggtggcggaggcggccgcggtgggggtgccgggggagacgggggag
gagatcgccgtcttcgtggtgccgcaggcccgggagttccccgaggagctcaagcccctc
ctggcggaaaagctcaaggcccacatcctgcggcacctgggccccgtcccgccgcccagg
gtcttcttccgggaacgccttccccggacccgctcggggaagatcctgaggcggctcctc
aaggcggagcttctcggcctagacccgggggacacctcgggactggaggaggactatggc
gctggaaaagctccttaa

DBGET integrated database retrieval system