KEGG   Thermus thermophilus JL-18: TtJL18_0800Help
Entry
TtJL18_0800       CDS       T02009                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00010  Glycolysis / Gluconeogenesis
ttl00620  Pyruvate metabolism
ttl00640  Propanoate metabolism
ttl00680  Methane metabolism
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_0800
   00620 Pyruvate metabolism
    TtJL18_0800
   00640 Propanoate metabolism
    TtJL18_0800
  Energy metabolism
   00680 Methane metabolism
    TtJL18_0800
Enzymes [BR:ttl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TtJL18_0800
Lipid biosynthesis proteins [BR:ttl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TtJL18_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFH38703
UniProt: H9ZQU3
Position
725777..727723
Genome map
AA seq 648 aa AA seqDB search
MDRLESVLKEERVFYPSEEFRKQAHIKSEEEYQRLYEESVRDPEGFWGRVASELHWFEPW
RKVLEGDLPHPKWFVGGKTNLSYNALDRHVKTWRRNKAAIVWEGEPGEERVLTYHDLWRE
VQRFANVLKRLGVKKGDRVTIYLPMIPEAAIAMLACTRIGAVHSVVFGGFSAGALADRIK
DAEAKVLITADGGFRRGGIVPLKQNADEALKDAPSVEHVVVVRRTGEEVPWTPGRDHWWH
ELMEAAPDRCDPEPMEAEEPLFILYTSGSTGKPKGVLHTTGGYMTYVYYTTKLVFDLKDE
DVYWCTADVGWITGHSYVVYGPLLNGATTVMYEGAPNWPEPDRFWRIVDKYGVTVFYTAP
TAIRSFMKWGEGWPGKHRLDSLRLLGTVGEPINPEAWLWYYHVIGKGRCPIVDTWWQTET
GGIMITTLPGAHAMKPGHAGKPFFGVVPEILDSEHRPVENPDEGGHLCITRPWPSMLRTV
WGDPERFLQQYFSQHPGVYFSGDGAKRDKDGYYMILGRVDDVLNVAGHRLGTMEIESALV
SHPAVAEAAVVGRPDPVKGEAIVAFVTLKEGHTPSDALKEELRAHVAKVIGPIARPDEIR
FTDALPKTRSGKIMRRLLRQIAAGEKEIKGDTSTLEDRSVVERLKEGA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggacaggctggagtcggtgctcaaggaggagcgggtcttttaccccagcgaggagttc
cgcaagcaggcccacatcaagagcgaggaggagtaccagcgcctctacgaggagagcgtc
cgtgaccccgaggggttctggggacgggtggcctcggagctccattggtttgaaccctgg
cggaaggtcctggaaggggacctgccccaccccaagtggttcgtgggggggaagaccaac
ctctcctacaacgccctggaccggcacgtgaagacctggcggcgcaacaaggcggccatc
gtttgggagggggagccgggggaggagcgggtcctcacctaccacgacctctggcgcgag
gtgcagaggttcgccaacgtccttaagcgcctgggggtgaagaagggcgacagggtcacc
atctacctccccatgatccccgaggcggccatcgccatgctcgcctgcacccggattggg
gccgtccattccgtggtcttcggcggcttctccgccggggcgctggcggaccggatcaag
gacgccgaggccaaggtcctcatcaccgccgacgggggcttccgccggggcgggatcgtc
cccctcaagcagaacgccgacgaggccctaaaggacgccccaagcgtggagcacgtggtg
gtggtgcgccgcaccggggaggaggtgccctggaccccgggccgggaccactggtggcac
gagctcatggaggccgcccccgaccggtgcgatcccgaacccatggaggcggaggagccc
ctcttcatcctctacacctccggctccaccgggaagcccaagggggtgttgcacaccacg
ggcggctacatgacctacgtctactacaccaccaagctggtctttgacctcaaggacgag
gacgtctactggtgcaccgccgacgtgggctggatcacggggcactcctatgtggtctac
gggcccctcctcaacggggccaccacggtgatgtacgagggggcccccaactggcctgag
cccgaccgcttttggcggatcgtggacaagtacggggtgaccgtcttctacaccgccccc
accgccatccgcagcttcatgaagtggggcgagggctggccgggcaagcaccgcctggac
tccctgaggctcctcggcaccgtgggcgagcccatcaaccccgaggcctggctctggtac
taccacgtgatcggcaagggccgctgtcccatcgtggacacttggtggcagacggagacg
ggcggcatcatgatcaccaccctccccggggcccacgccatgaagccggggcacgcgggg
aagcccttcttcggcgtggtgcccgagattttggacagcgagcaccgccccgtggagaac
cccgacgaggggggccacctctgcatcacccgtccctggcccagcatgctccgcaccgtc
tggggcgacccggagcgcttcctgcagcagtacttcagccagcaccccggggtctacttc
agcggcgacggggccaagcgggacaaggacgggtactacatgatcctgggccgggtggac
gacgttctgaacgtggccgggcaccgcctgggcaccatggagatcgagtccgccctggtc
tcccaccccgcggtggccgaggcggcggtggtgggcaggcccgatcccgtgaagggggag
gccatcgtggcctttgtgaccctgaaggaggggcacaccccctcggacgccctcaaggag
gagctcagggcccatgtggccaaggtcatcggccccatcgcccgcccggacgagatccgc
ttcaccgacgccctgcccaagacccgctcgggcaagatcatgcgccgcctcctccggcag
atcgccgccggggagaaggagatcaagggggacacctccaccctcgaggaccgctccgtg
gtggagcggctgaaggagggcgcctaa

DBGET integrated database retrieval system