KEGG   Thermus thermophilus JL-18: TtJL18_0800Help
Entry
TtJL18_0800       CDS       T02009                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TtJL18_0800
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_0800
   00620 Pyruvate metabolism
    TtJL18_0800
   00640 Propanoate metabolism
    TtJL18_0800
  Energy metabolism
   00680 Methane metabolism
    TtJL18_0800
Enzymes [BR:ttl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TtJL18_0800
Lipid biosynthesis proteins [BR:ttl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TtJL18_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
725777..727723
Genome map
AA seq 648 aa AA seqDB search
MDRLESVLKEERVFYPSEEFRKQAHIKSEEEYQRLYEESVRDPEGFWGRVASELHWFEPW
RKVLEGDLPHPKWFVGGKTNLSYNALDRHVKTWRRNKAAIVWEGEPGEERVLTYHDLWRE
VQRFANVLKRLGVKKGDRVTIYLPMIPEAAIAMLACTRIGAVHSVVFGGFSAGALADRIK
DAEAKVLITADGGFRRGGIVPLKQNADEALKDAPSVEHVVVVRRTGEEVPWTPGRDHWWH
ELMEAAPDRCDPEPMEAEEPLFILYTSGSTGKPKGVLHTTGGYMTYVYYTTKLVFDLKDE
DVYWCTADVGWITGHSYVVYGPLLNGATTVMYEGAPNWPEPDRFWRIVDKYGVTVFYTAP
TAIRSFMKWGEGWPGKHRLDSLRLLGTVGEPINPEAWLWYYHVIGKGRCPIVDTWWQTET
GGIMITTLPGAHAMKPGHAGKPFFGVVPEILDSEHRPVENPDEGGHLCITRPWPSMLRTV
WGDPERFLQQYFSQHPGVYFSGDGAKRDKDGYYMILGRVDDVLNVAGHRLGTMEIESALV
SHPAVAEAAVVGRPDPVKGEAIVAFVTLKEGHTPSDALKEELRAHVAKVIGPIARPDEIR
FTDALPKTRSGKIMRRLLRQIAAGEKEIKGDTSTLEDRSVVERLKEGA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggacaggctggagtcggtgctcaaggaggagcgggtcttttaccccagcgaggagttc
cgcaagcaggcccacatcaagagcgaggaggagtaccagcgcctctacgaggagagcgtc
cgtgaccccgaggggttctggggacgggtggcctcggagctccattggtttgaaccctgg
cggaaggtcctggaaggggacctgccccaccccaagtggttcgtgggggggaagaccaac
ctctcctacaacgccctggaccggcacgtgaagacctggcggcgcaacaaggcggccatc
gtttgggagggggagccgggggaggagcgggtcctcacctaccacgacctctggcgcgag
gtgcagaggttcgccaacgtccttaagcgcctgggggtgaagaagggcgacagggtcacc
atctacctccccatgatccccgaggcggccatcgccatgctcgcctgcacccggattggg
gccgtccattccgtggtcttcggcggcttctccgccggggcgctggcggaccggatcaag
gacgccgaggccaaggtcctcatcaccgccgacgggggcttccgccggggcgggatcgtc
cccctcaagcagaacgccgacgaggccctaaaggacgccccaagcgtggagcacgtggtg
gtggtgcgccgcaccggggaggaggtgccctggaccccgggccgggaccactggtggcac
gagctcatggaggccgcccccgaccggtgcgatcccgaacccatggaggcggaggagccc
ctcttcatcctctacacctccggctccaccgggaagcccaagggggtgttgcacaccacg
ggcggctacatgacctacgtctactacaccaccaagctggtctttgacctcaaggacgag
gacgtctactggtgcaccgccgacgtgggctggatcacggggcactcctatgtggtctac
gggcccctcctcaacggggccaccacggtgatgtacgagggggcccccaactggcctgag
cccgaccgcttttggcggatcgtggacaagtacggggtgaccgtcttctacaccgccccc
accgccatccgcagcttcatgaagtggggcgagggctggccgggcaagcaccgcctggac
tccctgaggctcctcggcaccgtgggcgagcccatcaaccccgaggcctggctctggtac
taccacgtgatcggcaagggccgctgtcccatcgtggacacttggtggcagacggagacg
ggcggcatcatgatcaccaccctccccggggcccacgccatgaagccggggcacgcgggg
aagcccttcttcggcgtggtgcccgagattttggacagcgagcaccgccccgtggagaac
cccgacgaggggggccacctctgcatcacccgtccctggcccagcatgctccgcaccgtc
tggggcgacccggagcgcttcctgcagcagtacttcagccagcaccccggggtctacttc
agcggcgacggggccaagcgggacaaggacgggtactacatgatcctgggccgggtggac
gacgttctgaacgtggccgggcaccgcctgggcaccatggagatcgagtccgccctggtc
tcccaccccgcggtggccgaggcggcggtggtgggcaggcccgatcccgtgaagggggag
gccatcgtggcctttgtgaccctgaaggaggggcacaccccctcggacgccctcaaggag
gagctcagggcccatgtggccaaggtcatcggccccatcgcccgcccggacgagatccgc
ttcaccgacgccctgcccaagacccgctcgggcaagatcatgcgccgcctcctccggcag
atcgccgccggggagaaggagatcaagggggacacctccaccctcgaggaccgctccgtg
gtggagcggctgaaggagggcgcctaa

DBGET integrated database retrieval system