KEGG   Thermus thermophilus JL-18: TtJL18_0965Help
Entry
TtJL18_0965       CDS       T02009                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00260  Glycine, serine and threonine metabolism
ttl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01130  Biosynthesis of antibiotics
ttl01230  Biosynthesis of amino acids
Module
ttl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TtJL18_0965
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TtJL18_0965
Enzymes [BR:ttl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TtJL18_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: AFH38865
UniProt: H9ZRA5
Position
879128..879925
Genome map
AA seq 265 aa AA seqDB search
MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPYADLLEIGLPYSDPLGDGP
VIQRASEVALRKGMSVQGALELVREVRALTEKPLFLMTYLNPVLAWGPERFFGLFKQAGA
TGVILPDLPPDEDPGLVRLAQEIGLETVFLLAPTSTDARIATVAAYATGFVYAVSVTGVT
GMRERLPEEVKDLVRRIKAKTPLPVAVGFGVSSRKTAAQAAVADGVVVGSALIRALEEGR
PLALLLQEVRQGLQRLEANPGLREG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccctcgaggccttcgccaaggcccggtccgagggccgggccgccctcatccct
tacctcaccgcgggcttccccagccgggagggctttttgcaggcggtggaggaggtcctc
ccctatgccgaccttctggagatcggccttccctactctgaccccctcggggatggcccc
gtgatccaaagggccagcgaggtggccctgaggaaggggatgagcgtccagggcgctttg
gagctcgtccgcgaggtgcgcgccctcacggagaaacccctcttcctcatgacctaccta
aaccccgtcctggcctgggggccggagcgcttcttcggcctcttcaagcaggcgggggcc
acgggggtgatcctccccgacctcccccccgacgaggacccgggcctcgtgcgcctcgcc
caggagatcggcctggagacggtcttcctcctcgcccccacctccacggatgcccgcatc
gccaccgtggcggcctacgccacgggcttcgtctacgccgtttccgtcaccggggtcacg
gggatgcgggagaggctacccgaggaggtgaaggacctggtgcgccgcattaaggccaag
acccctctccccgtggccgtggggtttggggtctccagccgaaagaccgccgcccaggcg
gcggtggcggacggggtggtggtgggaagcgccctgatccgggccttggaagaggggagg
ccccttgcgcttctcctccaggaggtccgccagggcctccagcgcctcgaggccaacccc
ggcttgagagaaggttaa

DBGET integrated database retrieval system