KEGG   Thermus thermophilus JL-18: TtJL18_1069Help
Entry
TtJL18_1069       CDS       T02009                                 

Definition
(RefSeq) fructose 1,6-bisphosphatase
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TtJL18_1069
   01230 Biosynthesis of amino acids
    TtJL18_1069
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_1069
   00030 Pentose phosphate pathway
    TtJL18_1069
   00051 Fructose and mannose metabolism
    TtJL18_1069
  Energy metabolism
   00680 Methane metabolism
    TtJL18_1069
Enzymes [BR:ttl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TtJL18_1069
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TtJL18_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
981505..982596
Genome map
AA seq 363 aa AA seqDB search
MKVTLSVLKADIGSVGGHTLPSRKVLAKVEEVVREEVGRLLLDAYVFHIGDDIVLLLSHT
RGVRNQEVHALAWKAFREGTEVAKAEGLYGAGQDLLKDAFTGNLHGLGPQVAEMEFTERP
AEPFMVLAADKTEPGAFNLPLYLAFADPMYSSGLLLSPELRPGFRFRIMDLAQTERDSYI
ELDAPERLYDIATLLRDSHRFAIESIWSRKHGEQAAVVSTTRLRNIAGRYVGKDDPVAIV
RTQKIFPATEEFGPVFALAPYVAGDTRGSHHMPLMPVRANTPASTFFCVPMVCGLAFSLR
EGRLSEPVDLFADPVWEAVRAKVVEKAQEMRRQGFYGPAMLPMEELEYTGIAERLKALER
EFS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaccttgagcgtgctcaaggcggacatcggctcggtgggcgggcacaccctg
cccagccgcaaggtcctcgccaaggtggaggaggtggtccgggaggaggtgggccgcctc
cttctggacgcctacgtcttccacatcggcgatgacatcgtcctcctcctatcccacacc
cggggggtgcggaaccaggaggtgcacgccctggcctggaaggccttccgtgagggcacc
gaggtggccaaggccgaaggcctctacggggcgggccaggacctccttaaggacgccttc
acggggaacctccacggcctcgggccccaggtggcggagatggagttcaccgagcgcccc
gcggagcccttcatggtcctcgccgccgacaagaccgagcccggggccttcaacctcccc
ctctacctggccttcgccgaccccatgtactcctcgggcctcctcctttccccggagctt
aggcccggcttccgcttccgcatcatggacctggcccagacggagcgggacagctacatt
gagctggacgcccccgagcgcctctacgacatcgccaccctccttcgcgactcccaccgc
ttcgccatagagtccatctggtcccggaagcacggggagcaggccgccgtggtgagcacc
acgcgcctgaggaacatcgccgggcgctacgtgggcaaggacgatcccgtggccatcgtc
cgcacccagaagatcttccccgccacggaggagttcggccccgtcttcgccctcgccccc
tacgtggcgggggacacccggggaagccaccatatgcccctgatgcccgtgcgggccaac
accccggcctccaccttcttctgcgtgcccatggtgtgcggcctggccttctccttgcgg
gaggggcggctttccgagcccgtggacctcttcgccgaccccgtgtgggaggcggtgcgg
gccaaggtggtggagaaggcccaggagatgcgccgccagggcttctacggccccgccatg
cttcccatggaggagctggagtacacggggatcgccgaacggctgaaggctttggagcgg
gagttcagctaa

DBGET integrated database retrieval system