KEGG   Thermus thermophilus JL-18: TtJL18_1110Help
Entry
TtJL18_1110       CDS       T02009                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ttl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ttl00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ttl00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:ttl00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021910..1022662
Genome map
AA seq 250 aa AA seqDB search
MRRVLVAGNWKMHKTPSEARVWFAELKRFLPPLQSEAAVLPAFPILPVAKEVLAETQVGY
GAQDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGI
TPILCVGEPLEVRERGEAVPYTLAQLLGSLEGLNPPGPEALVIAYEPVWAIGTGKNATPE
DAEAMHQEIRKALAERYGEAFASRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELE
SFLALLRIAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgtcttggtggcgggcaactggaaaatgcacaaaacgccctccgaggccagg
gtgtggttcgccgagctcaagaggttccttccccccttgcagtcggaggccgccgtcctc
cccgccttccccatcctccccgtggccaaggaggtgttggccgaaacccaggtgggctac
ggggctcaggacgtctccgcccacaaggaaggggcctacacgggggaggtctcggcacgg
atgctttccgacctcggttgccgctacgccatcgtgggccactcggagcgaaggcgctac
cacggggagacggacgccctggtggcggagaaggccaaaaggcttttggaagaggggatc
acccccatcctctgcgtgggggagcccctggaggtgcgggagcggggagaggcggtgccc
tacaccctggcccagctcttggggagcctcgagggcctgaaccccccgggtcccgaggcc
ttggtgattgcctacgagccggtctgggccatcggcacgggcaaaaacgccacccctgag
gacgccgaggccatgcaccaggagatccgcaaggccctcgccgagcggtacggggaggcc
ttcgcgagccgggttcgcatcctctacgggggaagcgtcaaccccaagaacttcgccgac
ctcctctccatgcccaacgtggacggggggctcgtgggcggggcgagcctggagcttgaa
agcttcctcgccctcctcaggatcgcgggttag

DBGET integrated database retrieval system