KEGG   Thermus thermophilus JL-18: TtJL18_1270Help
Entry
TtJL18_1270       CDS       T02009                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TtJL18_1270
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TtJL18_1270
Enzymes [BR:ttl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TtJL18_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1171474..1172379
Genome map
AA seq 301 aa AA seqDB search
MRHLLDFQGWTRPEVESLLDTARVMREVLERPVKKVPALQGFTVATVFFEPSTRTRISFE
LAARRMSADVVSFAAQTSSLQKGESYKDTLLTLEAMGVDAYVIRADSAGVPHQATRWVKG
TVINGGDGRRAHPTQALLDAYTLLEALGTLEGKKVAIVGDILHSRVARSNAELLSLLGAQ
VFCAGPPSLLPQSLPGAHLTPRLEEALEEADAVMVLRLQKERMEAGLVHLEDYVARYQVT
EKRLALAKPQAPLLHPGPMNRDVELEGTLADSARSLVNRQVQNGVAVRMAVLYHLLVGKG
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacctcctggacttccagggctggactaggcctgaggtggaaagcctcctggac
accgcccgggtgatgcgggaggtcctggagcggcccgtaaagaaggtccccgccctccag
ggcttcaccgtggccacggtcttctttgagccctccacaaggacgaggatctcctttgag
ctcgccgcaaggcgcatgtcggcggacgtggtctccttcgccgcccagacaagcagcctc
cagaagggggaaagctacaaggacaccctcctcaccctcgaggccatgggggtggacgcc
tacgtcatccgggccgacagcgccggcgtgccccaccaggccacccgctgggtcaagggc
accgtcatcaacgggggggacgggcgccgggcccaccccacccaggccctcctggacgcc
tacaccctcctcgaggccctgggcaccctggagggcaagaaggtcgccatcgtgggggac
atccttcactcccgggtggcccgctccaatgccgagctcctctccctcctcggggcccag
gtcttctgcgccggccccccgagcctcctcccccaaagcctccccggagcccacctcacc
ccccgtctggaggaggccctggaggaggcggacgccgtcatggtcctcaggctccagaag
gagcggatggaggcggggctcgtccacctggaggactacgtcgcccgctaccaggtgacc
gagaagaggctcgccctggccaagccccaagcccccctcctccaccccggccccatgaac
cgggacgtggagctggaggggaccttggcggactcggcgaggagcctggtgaaccgacag
gtgcaaaacggggtggcggtgcgcatggcggtgctctaccaccttttggtgggaaaaggg
aggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system