KEGG   Thermus thermophilus JL-18: TtJL18_1400Help
Entry
TtJL18_1400       CDS       T02009                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ttl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1297901..1298662
Genome map
AA seq 253 aa AA seqDB search
MRIAYAGLRRKEEFKALAEKLGFTPLLFPVQATEKVPVPEYRDHLRALAQGVDLFVATTG
VGVKDLLEAGKALGLDLRKPLEGAFRLARGAKAARTLRELGLPPHAVGDGTSKSLLPLLP
QGPGKAALQLYGKPLPLLENALAERSYRVLPLMPYRHLPDLEGILRLEAALLRGEVDALA
FVAAIQVEFLFEGAKDPKALREALNTRVKALAVGRVTADALREWGVEPFYVDETERLGSL
LQGYKRALQKEVA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcctacgccggcctaaggcgcaaagaggagtttaaggccctggcggaaaag
ctcggcttcacccctctcctcttccccgtccaggccacggaaaaggtccccgtccccgag
taccgggaccacctgcgggcgcttgcccaaggggtggacctctttgtggctaccaccggg
gtgggggtaaaagacctcctcgaggcgggaaaggccctgggcctagaccttagaaagccc
ttggaaggggcctttcgcttggcccggggcgccaaggccgcccgcaccttacgggagctc
ggccttcccccccacgccgtgggggacgggacctctaagagcctcctccccctcctcccc
cagggccccggcaaggccgccttgcagctttacggcaagccccttccccttctggaaaac
gccctggcggaaaggagctaccgggtccttcccctcatgccctaccgccacctcccggac
ctcgagggcatcctccgcctcgaggcggccctcctcagaggggaagtggacgccctcgcc
ttcgtggccgccattcaggtggagttcctctttgagggggcgaaagaccccaaggccctg
agggaagccctcaacacccgggtcaaggccctcgccgtgggccgggtgaccgccgacgcc
ttaagggagtggggggttgagcccttctacgtggacgagaccgagcggctgggaagcctg
cttcagggctacaaacgcgccctgcaaaaggaggtggcgtga

DBGET integrated database retrieval system