KEGG   Thermus thermophilus JL-18: TtJL18_1435Help
Entry
TtJL18_1435       CDS       T02009                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TtJL18_1435
Enzymes [BR:ttl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TtJL18_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1329285..1330679)
Genome map
AA seq 464 aa AA seqDB search
MKAKTLGELRRTYPLEKLRRTVKDEARENLREKLRRGERLFPGIHGYEDTVIPALVQAIL
AKQNFILLGTRGQAKSRILRSLTGLLDEEVPALATELRDNPLFPISPEGKRLLEEAGDDA
PIVWLSREDRYVEKLATPDTTVADLLGDMDPIKAARRGTGMADLESIHYGLLPRANRGIF
AVNELADLAPKVQVALFNILEEGDVQIRGYPIRLPLDVWLVFTANPQDYTARGRIVTPLK
DRIGSEIRTHYPRSLEEGARISAQEAYVPEGVLVPEWVRLSVEAVAFAAREDRRVDQTAG
VSQRLAISLLEVVAASAERRALLYGGRPVARPLDLYQGLPAITGKLELEYEGELQGAERV
AREIVQRAFGLVLPRYRLRTEPIVAHFEEGNLLTLPEGDVEEALKAMAGVPGLLEAARAL
AEGEAPEVLLSAGEFVLEGLVGRRKLSRGEASYQAAERPRSYGN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccaagaccctaggcgaactcaggcgcacctaccccctggagaagctccgccgc
accgtgaaggacgaggccagggagaacctccgggagaagctcaggcgtggggagaggctt
tttcccggcatccacggctacgaggacacggtgatccccgccctggtccaggccatcctc
gccaagcagaacttcatcctcctcggcacccggggccaggcgaaaagccggatcctgcga
agcctcacaggcctcctggacgaggaggtccccgccctcgccacggagcttcgcgacaac
cccctctttcccatctcccccgagggaaagcgccttctggaggaggccggggacgacgcc
cccatcgtctggctttcccgggaggaccggtacgtggagaagctcgccacccccgacacc
accgtggccgacctcctaggagacatggaccccatcaaggcggccaggcggggcacgggg
atggcggacctggagagcatccactacggcctcctgccccgggcgaaccgggggatcttc
gccgtgaacgagctcgccgacctcgcccccaaggtgcaggtggccctcttcaacatcctc
gaggagggggacgtgcagatccggggctaccccatccggctccccctggacgtgtggctg
gtcttcaccgccaacccccaggactacaccgcccggggcaggatcgtgacccccctcaag
gaccgcatcgggagcgagatccgcacccactacccccgctccctggaggagggggcccgg
atcagcgcccaggaggcctacgtgccggagggggtcctggtcccggagtgggtgaggctt
tccgtggaggccgtggccttcgccgcccgggaggaccgccgcgtggaccagacggcgggg
gtctcccagcgcctcgccatcagccttttggaggtggtggcggccagcgccgaaagaagg
gccctcctctacggaggaaggcccgtggcgaggcccttggacctctaccaggggcttccc
gccatcaccgggaagctggagttggagtacgaaggggagctccagggggcggagagggtg
gcgcgggagatcgtgcaaagggccttcggcctggttcttccccgctaccgcctgaggacc
gagcccatcgtggcccactttgaggaggggaacctcctcaccctgcccgaaggggacgtg
gaggaggcccttaaggccatggccggggtcccggggcttttagaagcggcaagggccctg
gccgagggggaagcccctgaggttttgctgtccgccggggagttcgtcctcgagggcctc
gtgggcagaaggaagctctcccggggcgaggcgagctaccaggcggcggagcgcccgagg
agctatggcaactag

DBGET integrated database retrieval system