KEGG   Thermus thermophilus JL-18: TtJL18_1477Help
Entry
TtJL18_1477       CDS       T02009                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TtJL18_1477
Enzymes [BR:ttl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TtJL18_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1368120..1369493
Genome map
AA seq 457 aa AA seqDB search
MAEVGVAVVGGGWAGLSAALVLKEAGADFLLLEASLRLGGKVRTARQEGFLVEGGPDASV
RYKKEVLELAQAFGLEPIGTLPEKPAAYILYRGKRHPLPEGLLQVVPGDLKALARTPLLS
LPGKLRALYDLFLPRGAKEDETLREFVERRLGPEVYRALVAPLAGGVYGGEPDDLSMRAA
FPQLWELEGRHRSLLLGAMRVRKGRGSREGGSLFFSFAEGLQALTRRMAEALGERVLRGT
PVLGLEPARGRWRLHTPKGALLAEAVVLAIPAPQAAGLLRPFLPEATALLKGIPHTPAAT
VSLAFPGALPVEGHGLLVAKGEGLRARGFTWTHRKWPGRVPEGFSLVRAYFSGEAARLSE
EALIRLALEDLARLLPGLPRVHRAWAFRFPEGMPAYRVGHLDRVERLEMALVKAPGLFLA
GNYLQGVGLPEVVRSGRRAAQRALAHLSLGEAHGASR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaggtaggggtggccgtggtgggcggggggtgggcggggctttccgccgccctt
gtcctgaaggaggcgggggcggacttcctcctcctggaggccagcctccgcctcgggggg
aaggtgcgcaccgcccggcaggagggcttcctggtggagggggggcccgacgccagcgtc
cgctacaagaaggaggtgctggagctcgcccaggccttcggcctcgagcccatcggcacc
cttccggaaaagcccgcggcctacatcctctaccgggggaagcgccaccccctgcccgaa
ggcctcctccaggtggtgcccggggacctcaaggccctggcccgcacccccctcctctcc
ctcccggggaagctccgggccctctacgacctcttcctcccccggggggcgaaggaggac
gagaccctgagggagttcgtggagaggcgcctggggcccgaggtctaccgggccctggtg
gcccccctggccgggggggtgtacgggggggagcccgacgacctctccatgcgggccgcc
tttccccagctctgggagctggagggaaggcaccggagcctcctccttggggccatgcgg
gtccggaaggggcggggaagccgggaggggggcagcctcttcttctccttcgccgagggc
ctccaggccctcacccggcggatggccgaggccctgggggagcgggtcctgcggggtacc
cccgtcctcggcctggagccagcccgcggaaggtggcgcctccacacccctaaaggggcc
ctcctcgccgaggccgtggtcctcgccatccccgccccccaggcggcgggcctcctcagg
cccttcctcccggaggccaccgctttgctcaaggggatcccccacaccccggcggccacg
gtgagcctggccttccccggggcgctccccgtggaggggcacgggctgcttgtggccaag
ggggaggggcttcgggcccgggggttcacctggacgcaccggaagtggccggggcgggtc
ccggaggggttcagcctggtgcgggcctacttctcgggggaggccgcccggctttccgag
gaggccctcatccggcttgccctggaggacctagcccgcctcctcccgggccttccccgg
gtccaccgggcctgggccttccgcttccccgaggggatgcccgcctaccgggtgggccac
ctggaccgggtggagcggctggagatggccctggtcaaggcgcccggcctcttcctcgcg
gggaactacctccagggggtgggcctgcccgaggtggtgcgctcggggaggcgggcggcg
caaagggccctggcccacctctccctaggcgaggcccatggagcttctcggtga

DBGET integrated database retrieval system