KEGG   Thermus thermophilus JL-18: TtJL18_1538Help
Entry
TtJL18_1538       CDS       T02009                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TtJL18_1538
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TtJL18_1538
   00640 Propanoate metabolism
    TtJL18_1538
   00660 C5-Branched dibasic acid metabolism
    TtJL18_1538
Enzymes [BR:ttl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TtJL18_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434118..1435254
Genome map
AA seq 378 aa AA seqDB search
MNLHEYQAKEILARYGVPVPPGKVAYTPEEAKRIAEEFGKRVVIKAQVHVGGRGKAGGVK
LADTPQEAYEKAQAILGMNIKGLTVKKVLVAEAVDIAKEYYAGLILDRAKKRVVLMLSKE
GGVDIEEVAAERPEAIHKFWIDPHKGFRPFEAREMVKRAGLEGNLNKLAQVLVALYRAYE
GVDASIAEINPLVVTTDGQIVAADAKIVLDDNALFRHPDLAELREVEAEHPLEVEASNYG
FAYVKLDGNIGIIGNGAGLVMYTLDLVNRVGGKPANFLDIGGGAKADVVYNALKVVLKDP
DVKGVFINIFGGITRADEVAKGVIRALEEGLLTKPVVMRVAGTAEEEAKKLLEGKPVYMY
PTSIEAAKAIVAMVGGAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctgcacgagtatcaagcgaaggagatcctggcccgctatggggtgcccgtgccg
ccgggaaaggtggcctacacccccgaggaggccaaacggatcgccgaggagttcggcaag
cgggtggtcatcaaggcccaggtgcacgtgggagggagaggaaaggcggggggcgtcaag
ctcgccgacaccccccaggaggcctacgagaaggcccaggccatcctgggcatgaacatc
aagggcctcaccgtgaagaaggtcctggtggccgaggcggtggacatcgccaaggagtac
tacgcgggcctcatcctggaccgggccaagaagcgggtggtcctcatgctctccaaggag
gggggcgtggacatcgaggaggtggccgcggagcgccccgaggccatccacaagttctgg
atagacccccacaaggggttccgcccctttgaggcccgggagatggtgaagcgggcgggg
ctcgagggcaacctcaacaagctcgcccaggtcctggtggccctctaccgggcctacgag
ggcgtggacgcctccatcgccgagatcaaccccctggtggtgaccacggacggccagatc
gtcgccgccgacgccaagatcgtcctggacgacaacgccctcttccgccaccccgacctg
gccgagctcagggaggtggaggccgaacaccccttggaggtggaggccagcaactacggc
ttcgcctacgtgaagcttgatggcaacatcggcatcatcggcaacggggcgggcctcgtg
atgtacaccctggatctggtgaaccgggtagggggcaagcccgccaacttcctggacatc
ggcggcggggccaaggcggacgtggtctacaacgccctcaaggtggtcctcaaggacccc
gacgtcaagggggtcttcatcaacatcttcggcggcatcacccgggcggacgaggtggcc
aagggggtgatccgcgccctggaggagggcctcctcaccaagcccgtggtgatgcgggtg
gcgggcaccgccgaggaggaggccaagaagcttttggaggggaagcccgtctacatgtac
cccacgtccattgaggcggccaaggccatcgtggccatggtgggaggtgcggcgtga

DBGET integrated database retrieval system