KEGG   Thermus thermophilus JL-18: TtJL18_1852Help
Entry
TtJL18_1852       CDS       T02009                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ttl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ttl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1719820..1721097
Genome map
AA seq 425 aa AA seqDB search
MGVSRVLHVEGGTPLKGELRVYPAKNAALPILAASLLTPEPITLVEVPRLRDVEVMLELL
AHLGTQYAWEGRTLHLQTPEIKSTHAPYELVGQMRASFIVWGALLARAGEGHVSMPGGCA
FGFRPVDQHIKALEALGAEVWEEDGTFHARRTRPLSGRVVFDLPTVGGTEQAMLAVALGG
EATLVQAAVEPEVVDLGHFLALLGAEVEGLGSPIVRIKGAPRLKGGTYRIIPDRIEAGTY
LLAAAATRGSLTLEGVRPDHLDALLDKLWRSGHRLEVGEDWIRFRATPDPAPFHVEAREY
PGFPTDLQPIATAYLATVPGQSTVVDRIYPDRFTHVGELARMGAELYLRDRILTVQGRRL
HGAQVKALDIRAGGALVVAALSAEGASEIEGVYFLERGYEHLTERLQALGARVHLRESPV
ALAAD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtgagccgggtgctgcacgtggaaggcggcacccccttgaagggggagcttagg
gtctacccggccaagaacgccgccctgcccatcctcgccgcgagcctcctcacccccgag
cccatcaccctggtggaggtgccgaggcttagggacgtggaggtgatgctggagctcctc
gcccacctgggcacccagtacgcctgggagggccggaccctccacctccagaccccggag
atcaaaagcacccacgccccctacgagctcgtgggccagatgcgggcgagcttcatcgtc
tggggagccctcctcgcccgggccggggaggggcacgtctccatgccggggggatgcgcc
ttcggcttccgccccgtggaccagcacatcaaggccctcgaggccctgggggcggaggtc
tgggaggaggacggcaccttccacgcccgcaggacccgccccctctcggggcgggtggtc
tttgacctgcccaccgtggggggcacggagcaggccatgctggccgtggccctgggcggg
gaggccaccctggtccaggcggcggtggagcccgaggtggtggacctgggccacttcctc
gccctcctcggggccgaggtggaggggctgggaagccccatcgtccgcatcaagggggcg
ccccggctaaagggcggcacctaccgcatcatccccgaccgcatagaggccgggacctat
ctcctggcggcggccgccacccggggaagcctcaccctggaaggcgtgcgccccgaccac
ctggacgccctcttggacaagctttggcgctcggggcaccggctcgaggtgggggaagac
tggatccgcttccgggccaccccggaccccgcccccttccacgtggaggcccgggagtac
ccgggctttcccacggacctccagcccatcgccaccgcctacctggccaccgtccccggc
cagagcacggtggtggaccgcatctaccccgaccgcttcacccacgtgggggagctggcc
cgcatgggggcagagctctacctgcgggaccggatcctcaccgtccagggcaggcggctc
cacggcgcccaggtcaaggccctggacatccgggccggaggggccttggtggtggcggcc
ctgagcgccgaaggcgcctcggagattgagggcgtctacttcctggagcggggttacgag
cacctcacggaaaggctccaggccctgggggcccgggtgcacctccgggaaagccccgtg
gccctggccgccgactga

DBGET integrated database retrieval system