KEGG   Thermus thermophilus JL-18: TtJL18_1904Help
Entry
TtJL18_1904       CDS       T02009                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ttl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1759868..1760671
Genome map
AA seq 267 aa AA seqDB search
MPELPEVETTRRRLRPLVLGQTLRQVVHHDPARYRNTALAEGRRILEVDRRGKFLLFALE
GGVELVAHLGMTGGFRLEPTPHTRAALVLEGRTLYFHDPRRFGRLLGVRRGDYREIPLLL
RLGPEPLSEAFAFPGFFRGLKESARPLKALLLDQRLAAGVGNIYADEALFRARLSPFRPA
RSLTEEEARRLHRALREVLAEAVELGGSTLSDQSYRQPDGLPGGFQAHHAVYGREGLPCP
ACGRPVERRVVAGRGTHFCPTCQGEGP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagcttcccgaggtggagaccacccgtaggcggctgcgccccctggtcctgggc
cagacccttaggcaggtggtccaccacgaccccgcccgctaccggaacacggccctggcg
gaggggaggcggatcctggaggtggaccgccgggggaagttcctcctcttcgccctcgag
ggcggggtggagctcgtggcccacctggggatgacgggggggttccggctggagcccacg
ccccacacccgggcggccctggtcctcgagggccggaccctctacttccacgacccccgg
cgcttcgggcgcctcttgggggtgcggcgcggggactaccgggagatccccctcctcctc
cgcctcggccccgagcccctctcggaggccttcgcctttcccgggttcttccgggggctg
aaggagagcgcgaggccccttaaggccctcctcctggaccagcgcctcgccgccggggtg
ggcaacatctacgccgacgaggccctcttccgcgcccgcctaagccccttccgccccgcc
cgaagcctcaccgaggaggaggcgcggcgcctccaccgggccctgcgcgaggtgctggcg
gaggccgtggaactcgggggaagcaccctctcggaccaaagctaccgccagcccgacggc
ctccccgggggcttccaggcgcaccacgccgtctacggccgggagggcctcccctgcccg
gcctgcgggcgcccggtggagcggcgggtggtggccgggcggggcacccacttctgcccc
acctgccagggggaaggcccctag

DBGET integrated database retrieval system