KEGG   Thermus thermophilus JL-18: TtJL18_1904Help
Entry
TtJL18_1904       CDS       T02009                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    TtJL18_1904
Enzymes [BR:ttl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     TtJL18_1904
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     TtJL18_1904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1759868..1760671
Genome map
AA seq 267 aa AA seqDB search
MPELPEVETTRRRLRPLVLGQTLRQVVHHDPARYRNTALAEGRRILEVDRRGKFLLFALE
GGVELVAHLGMTGGFRLEPTPHTRAALVLEGRTLYFHDPRRFGRLLGVRRGDYREIPLLL
RLGPEPLSEAFAFPGFFRGLKESARPLKALLLDQRLAAGVGNIYADEALFRARLSPFRPA
RSLTEEEARRLHRALREVLAEAVELGGSTLSDQSYRQPDGLPGGFQAHHAVYGREGLPCP
ACGRPVERRVVAGRGTHFCPTCQGEGP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagcttcccgaggtggagaccacccgtaggcggctgcgccccctggtcctgggc
cagacccttaggcaggtggtccaccacgaccccgcccgctaccggaacacggccctggcg
gaggggaggcggatcctggaggtggaccgccgggggaagttcctcctcttcgccctcgag
ggcggggtggagctcgtggcccacctggggatgacgggggggttccggctggagcccacg
ccccacacccgggcggccctggtcctcgagggccggaccctctacttccacgacccccgg
cgcttcgggcgcctcttgggggtgcggcgcggggactaccgggagatccccctcctcctc
cgcctcggccccgagcccctctcggaggccttcgcctttcccgggttcttccgggggctg
aaggagagcgcgaggccccttaaggccctcctcctggaccagcgcctcgccgccggggtg
ggcaacatctacgccgacgaggccctcttccgcgcccgcctaagccccttccgccccgcc
cgaagcctcaccgaggaggaggcgcggcgcctccaccgggccctgcgcgaggtgctggcg
gaggccgtggaactcgggggaagcaccctctcggaccaaagctaccgccagcccgacggc
ctccccgggggcttccaggcgcaccacgccgtctacggccgggagggcctcccctgcccg
gcctgcgggcgcccggtggagcggcgggtggtggccgggcggggcacccacttctgcccc
acctgccagggggaaggcccctag

DBGET integrated database retrieval system