KEGG   Thermus thermophilus JL-18: TtJL18_1962Help
Entry
TtJL18_1962       CDS       T02009                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TtJL18_1962
Enzymes [BR:ttl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TtJL18_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1821198..1821821)
Genome map
AA seq 207 aa AA seqDB search
MERKMVELEDTGLTFATEVDLERLQALAAEWLQVIGEDPGREGLLKTPERVAKAWAFLTR
GYRQRLEEVVGGAVFPAEGSEMVVVKGVEFYSMCEHHLLPFFGKVHIGYIPDGKILGLSK
FARIVDMFARRLQVQERLAVQIAEAIQEVLEPQGVGVVVEGVHLCMMMRGVEKQHSRTVT
SAMLGVFRENQKTREEFLSHLKDPLGL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcaagatggtggagcttgaggacacgggcttgaccttcgcgaccgaggtggac
ctggagcgcctccaggccctcgccgccgagtggctccaggtcatcggggaagaccccggc
cgcgaggggcttttgaagacgccggagcgggtggccaaggcctgggccttcctcacccgg
ggctaccggcagcgcctggaggaggtggtgggcggcgccgtgttcccggcggaggggagc
gagatggtggtggtgaagggcgtggagttctactccatgtgcgagcaccacctccttccc
ttcttcggcaaggtccacatcggctacatccccgacgggaagatcctgggcctctccaag
ttcgcccgcatcgtggacatgttcgcccgcaggctccaggtgcaggagcgcctcgcggtg
cagatcgccgaggccatccaggaggttctggagccccagggggtgggggtggtggtggag
ggggtccacctctgcatgatgatgcggggggtggagaagcagcactcccgcaccgtgacg
agcgccatgctgggggtcttccgggagaaccagaagacccgggaggagtttttgagccac
ctcaaagaccccttggggctatag

DBGET integrated database retrieval system