KEGG   Thermus thermophilus JL-18: TtJL18_2048Help
Entry
TtJL18_2048       CDS       T02009                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttl  Thermus thermophilus JL-18
Pathway
ttl00010  Glycolysis / Gluconeogenesis
ttl00030  Pentose phosphate pathway
ttl00051  Fructose and mannose metabolism
ttl00052  Galactose metabolism
ttl00680  Methane metabolism
ttl01100  Metabolic pathways
ttl01110  Biosynthesis of secondary metabolites
ttl01120  Microbial metabolism in diverse environments
ttl01130  Biosynthesis of antibiotics
ttl01200  Carbon metabolism
ttl01230  Biosynthesis of amino acids
ttl03018  RNA degradation
Module
ttl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_2048
   00030 Pentose phosphate pathway
    TtJL18_2048
   00051 Fructose and mannose metabolism
    TtJL18_2048
   00052 Galactose metabolism
    TtJL18_2048
  Energy metabolism
   00680 Methane metabolism
    TtJL18_2048
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TtJL18_2048
Enzymes [BR:ttl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TtJL18_2048
Protein phosphatases and associated proteins [BR:ttl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TtJL18_2048
Messenger RNA biogenesis [BR:ttl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TtJL18_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peptidase_C13
Motif
Other DBs
NCBI-ProteinID: AFH39900
UniProt: H9ZU90
Position
complement(1892705..1893673)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANI
IQRGGTILLTARSQEFLTEEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCLVEEHGMPV
VGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMGRNAGFIALD
VGLAGGAEVIAVPEEPVDPKAVAEVLEASQRRGKKSSIVVVAEGAYPGGAEGLLAAIQEH
LQVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALVGGASGVMVGEVEGEVDLTPLK
EAVERRKDINRALLRLSQVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcggggtgttcacgagcggcggcgacgcgccggggatgaacgcggccatc
cgggcggtggtgcgccaggcccacgcccttggggtggaggtcatcgggatccgccgcggc
tacgccggcatgatccaaggggagatggtgcccttgggggtgcgggacgtggccaacatc
atccagcggggcgggacgatcctcctcacggcgaggagccaggagttcctcacggaggaa
gggcgggccaaggcctacgccaagctgcaggcggcggggattgagggcctggtggccatc
ggcggcgacgggaccttccgcggggcgctttgcctcgtggaggagcacgggatgccggtg
gtgggggttccgggcaccatagacaacgacctctacggcacggactacaccatcggcttt
gacaccgcggtgaacacggccctcgaggccatagaccggatccgggacaccgcggcgagc
cacgagcgggtcttcttcatagaggtcatggggcggaacgcggggttcatcgccctggac
gtggggcttgccggcggggcggaggtcatcgccgtccccgaggagcccgtggaccccaag
gccgtggccgaggtgctggaggcctcccagaggcgtgggaagaagagctccatcgtggtg
gtggccgagggggcctaccccggcggggccgaggggcttctcgccgccatccaggagcac
ctccaggtggaggcccgggtcaccgtcctggggcacatccagcggggcgggagccccacg
gccaaggaccggattctggcgagccgcctgggggcggccgcggtggaggccctggtgggc
ggggcgagcggggtcatggtgggggaggtggagggcgaggtggacctcacccccctgaag
gaagcggtggagcgcaggaaggacatcaaccgggccctcttgcgcctatcgcaggtgctg
gccctctag

DBGET integrated database retrieval system