KEGG   Thermus thermophilus JL-18: TtJL18_2048Help
Entry
TtJL18_2048       CDS       T02009                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TtJL18_2048
   01230 Biosynthesis of amino acids
    TtJL18_2048
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TtJL18_2048
   00030 Pentose phosphate pathway
    TtJL18_2048
   00051 Fructose and mannose metabolism
    TtJL18_2048
   00052 Galactose metabolism
    TtJL18_2048
  Energy metabolism
   00680 Methane metabolism
    TtJL18_2048
Enzymes [BR:ttl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TtJL18_2048
Protein phosphatases and associated proteins [BR:ttl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TtJL18_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1892705..1893673)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANI
IQRGGTILLTARSQEFLTEEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCLVEEHGMPV
VGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMGRNAGFIALD
VGLAGGAEVIAVPEEPVDPKAVAEVLEASQRRGKKSSIVVVAEGAYPGGAEGLLAAIQEH
LQVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALVGGASGVMVGEVEGEVDLTPLK
EAVERRKDINRALLRLSQVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcggggtgttcacgagcggcggcgacgcgccggggatgaacgcggccatc
cgggcggtggtgcgccaggcccacgcccttggggtggaggtcatcgggatccgccgcggc
tacgccggcatgatccaaggggagatggtgcccttgggggtgcgggacgtggccaacatc
atccagcggggcgggacgatcctcctcacggcgaggagccaggagttcctcacggaggaa
gggcgggccaaggcctacgccaagctgcaggcggcggggattgagggcctggtggccatc
ggcggcgacgggaccttccgcggggcgctttgcctcgtggaggagcacgggatgccggtg
gtgggggttccgggcaccatagacaacgacctctacggcacggactacaccatcggcttt
gacaccgcggtgaacacggccctcgaggccatagaccggatccgggacaccgcggcgagc
cacgagcgggtcttcttcatagaggtcatggggcggaacgcggggttcatcgccctggac
gtggggcttgccggcggggcggaggtcatcgccgtccccgaggagcccgtggaccccaag
gccgtggccgaggtgctggaggcctcccagaggcgtgggaagaagagctccatcgtggtg
gtggccgagggggcctaccccggcggggccgaggggcttctcgccgccatccaggagcac
ctccaggtggaggcccgggtcaccgtcctggggcacatccagcggggcgggagccccacg
gccaaggaccggattctggcgagccgcctgggggcggccgcggtggaggccctggtgggc
ggggcgagcggggtcatggtgggggaggtggagggcgaggtggacctcacccccctgaag
gaagcggtggagcgcaggaaggacatcaaccgggccctcttgcgcctatcgcaggtgctg
gccctctag

DBGET integrated database retrieval system