KEGG   Thermus thermophilus JL-18: TtJL18_2064Help
Entry
TtJL18_2064       CDS       T02009                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TtJL18_2064
Enzymes [BR:ttl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TtJL18_2064
Exosome [BR:ttl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TtJL18_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTTJL1801:3647..5134
Genome map
AA seq 495 aa AA seqDB search
MRYLLALDQGTTSSRAILFTLEGRPVAVAKREFRQLYPKPGWVEHDPMEIWESQLWAAQE
ALRRAGVGGEAVLALGLTNQRETTLVWERATGRPLYNAIVWQDRRTASLCEALRARGLEP
LFRERTGLLFDPYFSGTKLLWLLENVPGLRARAERGEVCFGTVDTWLVWNLTGGKVFATD
PTNASRTLFFNLHTLAWDPELLEALGIPAALLPEVRPSDGDFGETLPELLGAPVPIRGVL
GDQQAALFGQAALGEGEGKCTYGTGAFLLLNTGKRPVLSEKGLLATVAWSLGGRATYALE
GSLFVAGAAVGWLKEVGLIRESAEVEALAASVEDTGDVYFVPAFTGLGAPYWDPYARGTL
LGLTRGTSRAHLARAALEGVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQAD
LLGVPVVVPEVTETTALGAALMAGVGAGALSPEDVAGRFREAERFLPTMPEGRREALYRR
WREAVERAKGWAREG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacctgctcgccttggaccaaggcaccaccagcagccgggccatcctcttcacc
ctggaggggaggcccgtggcggtagccaagcgggagttccggcagctttacccgaagccc
gggtgggtggagcacgacccgatggagatctgggagagccagctttgggccgcccaggag
gccctgaggcgggccggggtgggcggggaggcggttttggccctgggcctcaccaaccag
cgggagaccaccctggtctgggaacgggccacggggcggcccctttacaacgccatcgtc
tggcaggaccggcgcaccgcctccctttgcgaggccttgagggcgcggggcctggagccc
cttttccgggagcgcaccgggctcctctttgacccctacttctcgggaacgaagcttttg
tggctcttggagaacgtgcccggtctgagggcgcgggcggaaaggggagaggtctgcttc
ggcaccgtggacacctggctcgtctggaacctcacggggggaaaggtcttcgccaccgac
cccaccaacgcgagccgcaccttgttcttcaacctccacaccctcgcctgggacccggag
ctcctcgaggccctcgggatccccgccgccctcctcccggaggtgcggccctcggacggg
gacttcggggaaaccctccccgagctcctgggggcgcccgtccccatccggggggtcttg
ggggaccagcaggcggccctcttcggccaggcggccctaggggagggggaggggaagtgc
acctacggcaccggggccttcctcctcctgaacacggggaaaaggcccgtcctctccgaa
aagggccttctcgccacggtggcctggagccttggggggagggccacctatgccctcgag
gggagcctcttcgtggcgggggccgcggtggggtggctcaaggaggtgggcctcatccgg
gaaagcgccgaggtggaggccctggcggcaagcgtggaggacaccggggacgtctacttc
gtccccgccttcaccgggcttggcgccccctactgggacccctacgcccggggaaccctc
ctcggcctcacccgggggacgagccgggcccacctggcccgggcggccctggagggggtg
gccttccaggtgcgggacgtggttttggccatggaggaggaggccggggtccggctcaag
gtcctcaaggcggacgggggcatggcacaaaaccgcctcttcctcaagatccaggcggac
ctcctcggggtgcccgtggtggtgccggaggtgacggagaccaccgccttgggggcggcc
ctcatggccggggtgggggcgggggccctttccccggaggacgtggcggggcgcttccgc
gaggcggagaggttcctccccacgatgcccgaagggaggcgggaggccctctaccggagg
tggcgggaggcggtggaaagggccaagggctgggccagggaggggtag

DBGET integrated database retrieval system