KEGG   Thermus thermophilus JL-18: TtJL18_2077Help
Entry
TtJL18_2077       CDS       T02009                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ttl  Thermus thermophilus JL-18
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ttl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TtJL18_2077
  Amino acid metabolism
   00300 Lysine biosynthesis
    TtJL18_2077
Enzymes [BR:ttl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TtJL18_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTTJL1801:complement(25036..26193)
Genome map
AA seq 385 aa AA seqDB search
MERALLAAEAVEEKEVVDLLRALVRIPSHYPGPGEEGVAAFLEAFLKERGLKPFRQEAAP
GRPNLVADLGEGEGGLLLEGHTDVVTPGDEALWRYPPYGGVVEGKRLYGRGACDMKGGLA
ALVGAMLAVKRALGKPPRPLRLAALADEEGMMLGVKAFVKAGLAQGFRGALVAEPEEMEV
CLFQKGALRLCLRFPGRMAHGAMPYAGENPIPKAARFVLEVQQVEKRLQERFPHPYLGPP
YLTPTRFLATAGEGQLNVIPAEAEVALDVRTTPGVDHAGLVAELAALAGAEVEVLEDRPP
VETPKEDPLVQAAEEALRLLGLPVRHGGVPGATDGTFLRAWAGLPVVVMGPGQKTLPHQV
DEWVDLEEVVQAARVYAALAVLYLG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtggagcgggccctgctcgcggcggaggcggtggaggagaaggaggtggtggacctcctt
agggccctggtgcggatcccgagccactacccggggcccggggaggagggggtggcggcc
ttcctcgaggccttcctcaaggagcggggccttaagcccttccgccaggaggcggccccc
gggcggcccaacctggtggcggacctgggggagggggaaggagggctcctcctggagggg
cacacggacgtggtcacccccggggacgaggccctctggcgctacccgccctacgggggg
gtggtggaagggaaaaggctctacggccggggggcctgcgacatgaagggaggcctcgcc
gccctggtgggggccatgcttgcggtgaagcgggccttggggaagcctccccgccccttg
cgcctcgccgccctggcggacgaggaggggatgatgctcggggtgaaggccttcgtgaag
gcgggcctcgcccagggcttccggggggccttggtggccgagcccgaggagatggaggtc
tgcctcttccagaagggggccctgcgcctttgcctccgcttcccgggcaggatggcccac
ggggccatgccctacgccggggagaaccccatccccaaggcggcccgcttcgtcctggag
gtccagcaggtggaaaagcgcctgcaggagcgcttcccccacccctacctggggcccccc
tacctcacccccacccgtttcctggccacggcgggagaaggccagctcaacgtcatcccc
gccgaagccgaggtggccctggacgtgcgcaccaccccgggggtggaccacgctggcctc
gtggcggagctcgccgccctcgccggggccgaggtggaggttctggaggaccgccccccc
gtggagaccccaaaggaggaccccctggtccaggcggcggaggaagccctacggctcctc
ggccttcccgtgaggcacgggggggtgcccggggccacggacggcaccttcctccgggcc
tgggcggggcttcccgtggtggtcatggggcccggccagaagaccctcccccaccaggtg
gacgaatgggtggacctggaagaggtggtccaagccgcccgggtctacgccgccctcgcg
gtcctctatctaggctag

DBGET integrated database retrieval system