KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0052Help
Entry
Tthe_0052         CDS       T01299                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ttm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
55683..56282
Genome map
AA seq 199 aa AA seqDB search
MNVYSRSLSRLIDELSRLPGIGRKTAQRLAFYILDMPKDDVINLSNAILEAKNNLKYCNK
CYNFTDSDLCNICSDETRDSSTICVVSDPKDVVAMEKTREYRGLYHVLHGVISPMDGIGP
EDIKIKELLERINNNDIKEIILATNPDIEGEATAMYIAKLIKPFGIKVTRIAHGVPVGGD
LEYTDSVTLSRALEGRREM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttattcgaggtcattgtcaaggctgatagatgaattatcaagacttccaggt
attggacgaaaaacagcacagagacttgcattttacatcttggatatgccgaaagatgac
gttattaatttatctaatgctatattggaggcaaaaaacaatttgaaatactgcaacaag
tgttataatttcactgatagcgatttatgcaatatctgtagcgatgaaaccagagattca
tctactatttgtgtggtatctgatccgaaagatgtagtagctatggagaaaacaagggag
tatcgtggtttataccatgtgctgcatggtgtaatatcacccatggacggtataggacca
gaagatataaagataaaagaattgctagaaaggattaataataacgacataaaggagatt
atattagcgacaaatcccgatatagaaggcgaagcgactgctatgtacattgcaaaactt
ataaaaccttttggcataaaagtgacgaggatagcacatggtgtacctgttggtggtgac
ctcgaatatactgattctgttactttatcgagggcattggaaggtagaagggaaatgtaa

DBGET integrated database retrieval system