KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0072Help
Entry
Tthe_0072         CDS       T01299                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00010  Glycolysis / Gluconeogenesis
ttm00052  Galactose metabolism
ttm00500  Starch and sucrose metabolism
ttm00520  Amino sugar and nucleotide sugar metabolism
ttm00521  Streptomycin biosynthesis
ttm01100  Metabolic pathways
ttm01110  Biosynthesis of secondary metabolites
ttm01120  Microbial metabolism in diverse environments
ttm01130  Biosynthesis of antibiotics
ttm01200  Carbon metabolism
Module
ttm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tthe_0072
   00052 Galactose metabolism
    Tthe_0072
   00500 Starch and sucrose metabolism
    Tthe_0072
   00520 Amino sugar and nucleotide sugar metabolism
    Tthe_0072
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tthe_0072
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tthe_0072
Enzymes [BR:ttm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tthe_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADL67661
JGI: Tthe_0072
UniProt: D9TNB8
Position
85226..86173
Genome map
AA seq 315 aa AA seqDB search
MKKLVCGVDLGGTKINTGIMDSDGNILYNVKVPTEADKGPQHVINNIKKSIIDSLKNTKL
EIDQIAGIGIGAPGPLNADSGVVECPPNLPGWIDIHLVDILKQEFNTEIKLNNDANAAAL
AEHLFGAGQGIDDMVYVTVSTGIGGGAIIGGKLYNGANSNAAEIGHHSINFDGPRWCNCG
NPGCLESYASGTSLVKFAKKYIESGRDTILKNIPMDELKAENIFDAAKSGDELALKLIEN
EAFYLGVGIVNIMAFYNPKRIIIGGGLSSQWDVLYDKMMKTVKDRALKPNREICDVVKAK
LGGDVGLIGAAALVL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctggtctgtggtgttgatcttggcggtacaaagattaataccggtataatg
gatagtgatggtaacatattgtacaatgtaaaggttccaactgaggctgataaaggtccc
caacatgtaataaacaacataaagaagagcataatagattcattaaaaaatacaaagctg
gagatagaccagattgcaggtataggcataggcgcgcctggaccgttaaatgcagatagc
ggtgttgtggaatgtccgcctaatttacctggatggattgatattcatttagtcgacatc
ttaaaacaagaatttaatacagaaatcaagcttaataatgatgcaaatgctgctgcactt
gctgaacatttatttggagcagggcaaggtatagatgatatggtttatgtaactgtaagc
acaggtattggcggtggtgccataatagggggaaaattgtataatggagcaaactctaat
gcagcagagattggacaccactcgataaactttgatggccctagatggtgcaactgtggc
aatcccggctgcttggagtcttatgcttctggtacatcgctagttaaatttgctaaaaaa
tatatagaatcaggaagagataccattcttaaaaacatcccgatggatgaactgaaggct
gagaatattttcgatgcagcgaagtcaggtgatgaattagctttgaagcttatagaaaat
gaagcattttatttaggagtaggtattgtaaatataatggctttttataatccaaagagg
ataataataggtggtggcctttcaagtcaatgggatgttttatacgataagatgatgaag
acagttaaagatagagcattgaagccaaacagagaaatttgcgatgttgtcaaagcaaag
cttggtggagatgttggacttataggtgctgctgcacttgttttgtaa

DBGET integrated database retrieval system