KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0072Help
Entry
Tthe_0072         CDS       T01299                                 

Definition
glucokinase, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tthe_0072
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tthe_0072
   00052 Galactose metabolism
    Tthe_0072
   00500 Starch and sucrose metabolism
    Tthe_0072
   00520 Amino sugar and nucleotide sugar metabolism
    Tthe_0072
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tthe_0072
   00524 Butirosin and neomycin biosynthesis
    Tthe_0072
Enzymes [BR:ttm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tthe_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
85226..86173
Genome map
AA seq 315 aa AA seqDB search
MKKLVCGVDLGGTKINTGIMDSDGNILYNVKVPTEADKGPQHVINNIKKSIIDSLKNTKL
EIDQIAGIGIGAPGPLNADSGVVECPPNLPGWIDIHLVDILKQEFNTEIKLNNDANAAAL
AEHLFGAGQGIDDMVYVTVSTGIGGGAIIGGKLYNGANSNAAEIGHHSINFDGPRWCNCG
NPGCLESYASGTSLVKFAKKYIESGRDTILKNIPMDELKAENIFDAAKSGDELALKLIEN
EAFYLGVGIVNIMAFYNPKRIIIGGGLSSQWDVLYDKMMKTVKDRALKPNREICDVVKAK
LGGDVGLIGAAALVL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctggtctgtggtgttgatcttggcggtacaaagattaataccggtataatg
gatagtgatggtaacatattgtacaatgtaaaggttccaactgaggctgataaaggtccc
caacatgtaataaacaacataaagaagagcataatagattcattaaaaaatacaaagctg
gagatagaccagattgcaggtataggcataggcgcgcctggaccgttaaatgcagatagc
ggtgttgtggaatgtccgcctaatttacctggatggattgatattcatttagtcgacatc
ttaaaacaagaatttaatacagaaatcaagcttaataatgatgcaaatgctgctgcactt
gctgaacatttatttggagcagggcaaggtatagatgatatggtttatgtaactgtaagc
acaggtattggcggtggtgccataatagggggaaaattgtataatggagcaaactctaat
gcagcagagattggacaccactcgataaactttgatggccctagatggtgcaactgtggc
aatcccggctgcttggagtcttatgcttctggtacatcgctagttaaatttgctaaaaaa
tatatagaatcaggaagagataccattcttaaaaacatcccgatggatgaactgaaggct
gagaatattttcgatgcagcgaagtcaggtgatgaattagctttgaagcttatagaaaat
gaagcattttatttaggagtaggtattgtaaatataatggctttttataatccaaagagg
ataataataggtggtggcctttcaagtcaatgggatgttttatacgataagatgatgaag
acagttaaagatagagcattgaagccaaacagagaaatttgcgatgttgtcaaagcaaag
cttggtggagatgttggacttataggtgctgctgcacttgttttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system