KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0140Help
Entry
Tthe_0140         CDS       T01299                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ttm00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ttm00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
147944..150133
Genome map
AA seq 729 aa AA seqDB search
MPIHYYEKSKSFKLDAKDTSYIMAVVDEEKFLGHVYFGERIPDEDVNYLMRLDEPPYVPS
KNNRDRMSFLDSFPTEYPTSGLGDFREPCLKVLTKLGATACGIFYKSHKIYKGKPKLNGL
PATFGNEDDCTTLEITCVDNHLNLEVILIYTVFEDLDVITRSVKVKNCSDEDIILTRVLS
ACVDFDRIDMDMVTLHGSWAREFHVKRRKVELGKQAVSSSRGETSHQANPFLALMDRNAT
EDFGEVYGFNLVYSGNFLAQVEGCQFDTTRVVMGINPFDFGWKLEPQEEFVAPEVVMVYS
NEGIGKMSRTFHDLYRNHLIRGEYKNKRRPVLINSWEAAYFDFDTDKLLRLAREASKLGI
EMLVMDDGWFGKRNSDNCSLGDWVVNEEKLKGGLKYLVDEVNKLGMKFGIWFEPEMVSPD
SDLYRAHPDWCIHIDGREGTLCRNQYVLDLSRKEVRDYVYESVSNILRSANIKYVKWDMN
RQLSDVGNCVLPPDRQREIWHRYVLGVYELMDRLTTEFPHILLENCSGGGGRFDPGMLYF
SPQIWLSDDTDAIERLKIQHGASYVYPVSTMGAHISDCPNHIIGRITPFETRGLVALSGT
FGYELDVTKISQEDKDMIPKQIEMYNKYNNLIYNGDLYRIGNPFENIEFECVEYVSKDKN
EALVVYIQILNRSNYHSRRIPLKGLQKDAFYRNEETNEVFSGSALMNGGILIKGLQGDFR
GKLFHFVHV
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcctatacattattatgagaagtcgaaatcatttaagcttgatgcaaaagatacaagt
tatataatggctgtcgttgatgaagaaaagtttttaggtcatgtctacttcggagagagg
attcctgatgaagatgtgaattacctgatgagattggatgaacctccttatgttccttca
aagaataacagagacaggatgtcgtttttagatagcttccctacagaataccctacaagt
ggtttgggggattttagagagccatgtttaaaggttctgacaaagttaggagccactgca
tgtgggattttttacaagtcacataaaatatataaaggcaagccaaaattaaatggcttg
ccagcgacgtttggcaatgaagacgactgtactacacttgaaataacgtgtgttgataat
catttaaatctggaagttattttgatttatacggtttttgaagatttagatgtaataacg
agaagtgtaaaagtaaaaaattgctctgatgaagatatcatattgacaagagtgttgtct
gcatgtgttgattttgaccgaattgacatggatatggtaacattgcatggctcttgggcc
agagaatttcatgtaaagagaaggaaagttgagcttgggaaacaagctgtttcatcatct
agaggtgagacaagtcatcaggcaaatccgtttttagctttaatggatagaaatgccact
gaagattttggtgaagtctatggatttaaccttgtctattctggcaattttttagcacag
gtagaaggatgtcagtttgatacaactcgcgttgttatgggtataaatccgtttgatttt
ggatggaaacttgaacctcaggaggaatttgtggcaccagaagtagtgatggtctattca
aacgaaggcattggaaaaatgtcacgaacttttcacgatctataccgcaatcatcttata
cggggggaatataaaaataaaagaagacctgtccttataaatagctgggaagctgcatat
tttgactttgatacagataagcttttaagattggcaagagaagcatcgaagctgggaatt
gagatgcttgtaatggacgatggctggtttggaaagcgaaacagtgataattgttctcta
ggtgattgggtcgtcaatgaagaaaagttaaaaggagggcttaaatatctagtagatgaa
gtaaataaacttggcatgaagtttgggatatggtttgagcctgagatggtttcgccagat
tctgacctttatagggcacatccggattggtgcatacacatagatggaagagaaggtaca
ctgtgccgcaatcagtatgtactggatttgtctagaaaggaagtcagagattacgtatat
gaaagcgtaagcaatattttacgcagtgcaaacataaaatatgtaaagtgggatatgaat
aggcagcttagcgatgtcggaaattgtgtattgccacccgatcgtcagagagaaatatgg
cacagatatgttttaggtgtatatgagcttatggacaggcttacgacagaatttccgcat
atccttttggaaaattgctctggaggaggagggcgctttgatcccggaatgctgtatttc
agccctcagatatggctttcagatgatacagatgcgattgagaggcttaaaatccagcat
ggtgcctcatacgtatatcctgtatcaacaatgggtgctcacataagcgactgtccaaac
cacattattggaagaatcactccttttgagacgagaggacttgtggcattgtccgggact
ttcggatatgaattggatgttacaaagatatctcaggaagacaaggatatgataccgaag
caaatagagatgtacaataagtacaataatttgatatacaatggggatttataccgtata
ggaaatccatttgaaaatatagagtttgaatgcgtagagtatgtttcgaaggacaaaaat
gaggcattggttgtatatattcaaatcttgaataggtccaattaccatagcagaagaatc
ccgttaaagggtttacagaaagatgctttttatcgcaatgaagagacaaatgaagttttt
tcaggaagcgctcttatgaacggtggaatcctcataaaaggattgcaaggagactttaga
gggaaattgtttcactttgtgcatgtgtaa

DBGET integrated database retrieval system