KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0381Help
Entry
Tthe_0381         CDS       T01299                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tthe_0381
Enzymes [BR:ttm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tthe_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
376120..376683
Genome map
AA seq 187 aa AA seqDB search
MIDKEKIKKAVYDILEAIGEDPNREGLLETPDRVARMYEEIFSGLHTDVMDVIKTFKEDE
HQEIVIVKDIPMYSMCEHHLLPFMGVAHVAYLPRKGTILGLSKLARIVDVLAKKPQLQER
LTSEIADTIVKAANPLGVAVVVEAEHLCMTMRGIKKPGAKTVTSALRGLFKTDQRSREEV
MLLINGK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgataaagaaaagataaaaaaggctgtttatgatatacttgaagctattggagaa
gatccaaatagggaagggcttttagagacgcctgatagagttgcacgaatgtatgaagag
atattttcaggacttcatacggatgtcatggatgtgataaagacttttaaagaagatgag
catcaagagatagtcatagtgaaagatatacctatgtattctatgtgtgaacatcattta
ttgccatttatgggtgtggcacatgtagcgtaccttccaaggaaagggacaatacttggt
ctttctaaacttgctagaatagttgatgttttagcaaagaagccacagctacaagagagg
cttacgagtgagattgctgatacaattgttaaagctgcaaatcctttaggtgttgctgta
gtcgttgaagcagagcacctttgcatgacgatgcggggcatcaaaaaacccggtgccaaa
acggtcacatctgctttaagagggttgtttaaaacagatcagaggtctagggaagaagtt
atgcttttaataaatggtaaatga

DBGET integrated database retrieval system