KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0383Help
Entry
Tthe_0383         CDS       T01299                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ttm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
377521..378018
Genome map
AA seq 165 aa AA seqDB search
MTDTYMSIGSNVGDREGYLKSALIKLTKNSVIIEKVSPIYETEPVGYKEQGKFLNAVVQT
KTELKPHELLKVINTVEKELGRERLIRWGPRTIDIDILLYGDVTINDDDLKIPHERMWER
AFVLVPLNDIAPNIVKGGMKLSDIVESLPDKIGVRLYKRDWYKVV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacggatacatatatgtcgattggctctaacgtgggagatagggaaggatacttaaaa
agtgcacttattaagcttacaaagaattcggttatcatagaaaaagtatctcccatttat
gagacagaacctgttggatataaagaacaaggcaaatttttaaatgcggtggtacagaca
aagacggaacttaagccccatgagctgcttaaggtcattaatactgtagaaaaagagctt
ggaagagagaggcttataagatggggaccccgtacaattgacatagatatactgttgtat
ggtgatgtaactataaatgatgatgacttaaagatacctcatgagagaatgtgggagaga
gcgtttgtacttgtgccacttaatgatattgctcccaacattgtgaagggtggaatgaaa
ttatcagatattgtagaatcgctgcctgataaaattggcgtcagactgtataaaagagat
tggtataaggtggtgtag

DBGET integrated database retrieval system