KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0409Help
Entry
Tthe_0409         CDS       T01299                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tthe_0409
Enzymes [BR:ttm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Tthe_0409
Amino acid related enzymes [BR:ttm01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Tthe_0409
Transfer RNA biogenesis [BR:ttm03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Tthe_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
405920..407374
Genome map
AA seq 484 aa AA seqDB search
MEKRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGAKLILRIEDTDLTRSSKDFEKLIFKE
LNWLGIEWDEGPDKPGDYGPYRQSERLHIYRQYAEQLIKEGKAYRCYCTPEELDKDREES
VKRGDIPRYSGRCRHLTKEQEEEYLRQGRKPSIRFIIPDDVIIAFDDMIKGRIEIKSDTL
GGDMIIVKSDGMPTYNFAVVIDDTLMKISHVIRGEDHIYNTPKQLLIYEALGFKPPVFAH
APLILGPDRTKLSKRHGNTYIGQYREMGYLPEAMFNFLSLLSWSPEDNVELMSKDEIIKK
FNFNKIHSANPVFDIEKLNWMNQHYIQMSSVDRIVDLAIPYFKEAGYIKDVDDKTYEWLK
KVVSLFKDGLHYVAELKDKAKMFFDDDIEYDDNLKDDILCGDAMKVLKSFKEEIENMEDI
SEESVKTLLKMLQKKIGVKGKAFFMPIRFAITGQDHGPELVMIIPLLGKQKILYRIDKAM
KLIS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagagttagatttgcaccaagtcctacaggtgcgattcatattggtaatata
cgtacggctttgtttaattatctattttcaagaagcgaaggtgctaagctgatattaagg
atagaagatacggatttgactaggtcgtcaaaagattttgaaaagctcatctttaaagag
ttaaattggcttggcattgagtgggacgaagggcctgataaacctggtgattatggacct
tacagacaaagcgaaaggcttcatatttatagacaatatgcagaacaacttataaaagaa
ggtaaggcgtacagatgttactgtacacctgaagaactggataaagatagggaagagtct
gttaaaagaggcgacataccgaggtattcgggaagatgtagacatttgactaaagaacag
gaagaggaatacttaagacaaggcagaaaaccatcaatcaggtttattatacctgatgat
gttataatagcgtttgatgatatgataaaagggagaatagagattaaatcagatacactg
ggtggagatatgataatagttaaatctgatggcatgcccacttacaattttgcagttgta
attgatgatactcttatgaagatctcgcacgttataagaggggaagaccacatttacaat
acaccgaagcagctgcttatatatgaagcattaggttttaaaccgcccgtattcgcgcat
gcgccactcatcttagggccagataggactaagctgtcaaagaggcatggcaatacttac
attggacagtatagagagatgggttatcttcctgaggccatgtttaactttttatcgctt
ttaagctggtcgcctgaggataatgtcgaattgatgtcaaaagatgaaataatcaaaaag
tttaatttcaataaaattcacagtgcaaatcctgtgtttgacattgaaaagttaaactgg
atgaatcagcattatattcaaatgagttctgtagatagaatagtagacctagcaatacca
tattttaaagaagcaggttatatcaaagatgttgatgataagacttatgaatggttaaaa
aaggtagtgtctcttttcaaagacggtctacattatgttgcagaattaaaagacaaagcg
aaaatgttttttgatgatgatattgaatatgacgataatctaaaagacgatatattatgt
ggcgatgcaatgaaagttttgaagagcttcaaagaagagatcgaaaatatggaagatatc
agtgaagagtctgttaaaacattgcttaagatgttgcagaagaagataggggttaaaggc
aaggcatttttcatgcctataagatttgctataacaggacaggatcatggaccagaactt
gtaatgataattcctcttttaggtaaacaaaagatattatacaggattgataaagcgatg
aaattaatatcgtaa

DBGET integrated database retrieval system