KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0472Help
Entry
Tthe_0472         CDS       T01299                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00010  Glycolysis / Gluconeogenesis
ttm00071  Fatty acid degradation
ttm00350  Tyrosine metabolism
ttm00625  Chloroalkane and chloroalkene degradation
ttm00626  Naphthalene degradation
ttm01100  Metabolic pathways
ttm01110  Biosynthesis of secondary metabolites
ttm01120  Microbial metabolism in diverse environments
ttm01130  Biosynthesis of antibiotics
ttm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tthe_0472
  Lipid metabolism
   00071 Fatty acid degradation
    Tthe_0472
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tthe_0472
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tthe_0472
   00626 Naphthalene degradation
    Tthe_0472
Enzymes [BR:ttm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tthe_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 rpo132
Motif
Other DBs
NCBI-ProteinID: ADL68041
JGI: Tthe_0472
UniProt: D9TSE3
Position
459040..460221
Genome map
AA seq 393 aa AA seqDB search
MKSNFTYFMPTEIIFGPGTLEKLATVRLPGKKALLVIGSGNSMRKHGYLDRVTSYLKQNN
VDYVVYDKILPNPIADHVAEGAKLAKENECDFVIGLGGGSTIDSSKAIAVMAKNPGDYWD
YVSGGSGKGMEVKNGALPIVAIPTTAGTGTESDPWAVVTKTETNEKIGFGCKYTYPTLSI
VDPELMVSIPPKFTAYQGMDAFFHSVEGYLATVNQPGSDVLALQSINLITENLPKAVEDG
NNIEARTALAWASTAAGIVESLSSCISHHSMEHALSAYHPDIPHGAGLIMLSVSYFSFMA
SKVPDRFVDIAKAMGEEINGATKEEQAISFIKGLKKLIKNIGMEDLSLSGFGVKEDEIEK
LSRNAMDTMGGLFQVDPYKLSLEEVMSIYKNCF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaattttacatactttatgccgacagaaattatttttggtcctggtactctt
gaaaagttagctacagtccgattgcctgggaagaaagctcttctggtgattggaagcgga
aattctatgagaaaacatgggtatttagatagagtaacaagttatttgaaacaaaacaat
gttgattatgtagtgtatgataaaatattgccaaatcctatagccgatcatgtggcagaa
ggtgcaaaattggcaaaggagaatgaatgtgattttgttatagggcttggtggtggcagc
actatagactcatcaaaagctatagctgtcatggctaagaatcctggtgactattgggac
tatgtatctggcggaagcggaaaaggtatggaagtcaaaaacggggcattgcctatagtt
gctataccgacaactgcaggtacaggcacagaatctgatccatgggccgttgtgacgaag
acagagacaaatgaaaagattggttttgggtgcaaatatacatatccaacactttcaata
gttgaccctgaattaatggtatcaattccgccaaagtttactgcgtatcaagggatggat
gcatttttccattccgttgaaggatatctcgcaactgtcaatcaaccaggaagcgatgtt
ttagcacttcaatcaataaaccttattacagagaatcttccaaaagctgttgaggatgga
aacaatattgaggctcgtacagcactggcatgggcaagcacagcagcaggaatagtagaa
tcattatcttcatgtatttcgcatcattcgatggaacatgctttaagtgcatatcaccct
gatataccacacggagcgggccttataatgctatctgtatcttactttagctttatggct
tcaaaagttcctgatagatttgtagatattgcaaaggccatgggcgaagagataaatgga
gctactaaagaagagcaagctatatcctttataaaaggtctaaaaaaattaattaagaat
ataggaatggaagatttgagcttgtcaggctttggagttaaagaagatgaaatagaaaag
ctgtctaggaatgctatggatacaatgggaggactatttcaggttgacccatataagctg
tcattagaagaggtaatgtccatatacaaaaactgcttttaa

DBGET integrated database retrieval system