KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0586Help
Entry
Tthe_0586         CDS       T01299                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tthe_0586
Enzymes [BR:ttm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tthe_0586
Exosome [BR:ttm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tthe_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
581546..583036
Genome map
AA seq 496 aa AA seqDB search
MAKYIMALDQGTTSSRAIIFDHSGNIVSSINKEFTQIYPNPGWVEHDPMEILDSQIEVAK
AVLEKTGIKAEDIAAIGITNQRETTVVWDKNTGKPVYNAIVWQCRRTAPICDEIKNNGFD
KEILKKTGLIVDAYFSGTKIKWILDNVEGARERAENGDLYFGNIDSWLIWNLTGGKAHVT
DYSNASRTMLFNIYELKWDKDILEYLGIPESMLPDVKPSSYVYGYTDKSIFGVEIPIAGD
AGDQQAALFGQTCYDKGMAKNTYGTGCFMLMNTGEKAVPSKNGLLTTIAWGIEDKVEYAL
EGSIFIAGAAIQWLRDELKIIENSPQSEEYALKVSDTNGVYVVPAFVGLGAPYWDMYARG
AILGITRGVKREHIIRATLESLAYQTRDVLEAMQEDSGIKLSALKVDGGASTNNFLMQFQ
SDILGVPVDRPTVIETTALGASYLAGIATGFWNGREEVAKNWGVDRHFEPNMDIKTREKL
YAGWKKAVERSKNWAE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatatataatggcattagatcagggaacaacaagttcaagggcaataatcttc
gatcacagcggaaacattgtatcgtctataaataaggagtttacacagatttatccaaat
ccgggttgggtagagcatgaccctatggagattttagattcacagatagaagtagcaaaa
gcggtacttgaaaaaaccggcataaaagcagaagacattgcagcaataggcataactaat
caaagagaaacaaccgtcgtatgggacaaaaacactggtaaacctgtatacaatgcgata
gtgtggcagtgcaggaggactgcacctatatgcgatgaaatcaagaacaacgggtttgac
aaagagattttaaaaaagacaggactcatagttgatgcatatttttcagggacaaaaatc
aaatggatactggataacgtagaaggtgcaagagaaagagcagaaaatggggatctctat
tttggcaatatagatagctggcttatatggaatctaaccggcggcaaagcccacgtgact
gactattccaatgcatcacgtacgatgctttttaatatatatgaattgaagtgggataaa
gatatattagaatatctaggcattccagagtcgatgctgccagatgtcaaaccttctagc
tacgtatacggatatacggacaagagcatatttggcgttgaaatccctatagcaggtgac
gcaggggaccagcaggcagcactgtttgggcagacttgttatgacaaaggcatggctaaa
aacacttatggaacaggatgctttatgctgatgaatacaggtgaaaaagctgttccatct
aaaaacggactgcttacaacaatagcatggggaattgaggataaagtagaatatgcacta
gaaggaagcatattcatagccggagccgctatacaatggctgagagatgagcttaagata
atagaaaattcgccgcagagcgaggagtatgcactaaaagttagtgatacaaacggcgta
tatgtagtgcctgcgtttgttggattgggtgctccttactgggatatgtatgcaagaggt
gcgattttaggaataaccagaggagtaaaaagagagcatattataagggctacgctggag
tctttagcgtatcagacgagagacgttctagaagcaatgcaggaagattcagggataaaa
ttgagtgcattaaaagttgacggcggtgcgtctacaaacaatttcttgatgcagttccag
tcagatatattgggtgtaccagtggatagacctactgttatagagacaactgctcttggt
gcatcatatcttgcaggtattgctacaggcttttggaacggcagagaagaagttgctaaa
aactggggcgttgacaggcattttgagcccaatatggatataaagacaagagaaaaacta
tatgcaggatggaagaaagcagtagaaaggtctaagaattgggcagagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system