KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0770Help
Entry
Tthe_0770         CDS       T01299                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tthe_0770
   01230 Biosynthesis of amino acids
    Tthe_0770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tthe_0770
   00030 Pentose phosphate pathway
    Tthe_0770
   00051 Fructose and mannose metabolism
    Tthe_0770
   00052 Galactose metabolism
    Tthe_0770
  Energy metabolism
   00680 Methane metabolism
    Tthe_0770
Enzymes [BR:ttm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tthe_0770
Protein phosphatases and associated proteins [BR:ttm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tthe_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
793287..794252
Genome map
AA seq 321 aa AA seqDB search
MKTIGVLTSGGDAPGMNAAIRAVVRCGIYNGLTVKGIMRGYQGLIDDEIEDMTLSSVGDI
IQRGGTILRTARSAEFKTKEGRAKAAEVLKKHGIEGLVIIGGDGSFRGAQLLSNEHGVNT
IGIPGTIDNDIPCTDYTIGFDTACNTAIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGLAGGAEIIIIPEVKFDIDEVCDKISYGIKRGKLHHIIVLAEGVMSGLELSKMIQERLP
KLDLRHTTLGHIQRGGAPSVMDRIIASQMGSRAVELLLENKSQRIISIRNNQIVDDDIDT
ALAMRKEFNFKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactataggagtattaacaagtggtggagatgcgccaggcatgaatgccgcaata
agggcagttgtaagatgcggtatatacaatggactcacagttaaaggcatcatgagagga
tatcaaggacttattgacgatgaaatagaagacatgacattgtcatctgtaggtgatatt
atacagaggggtggcacaatacttcgaacagccagaagtgctgagtttaaaacaaaagaa
ggtagagctaaagctgcagaagttctaaaaaaacatggaattgaaggacttgtaatcatt
ggtggcgatggttctttcagaggggcacaattgttaagcaatgagcatggagtcaatact
attggaataccaggtactattgacaacgacataccatgtactgactatacaattggtttt
gacacagcgtgtaacactgcgatagatgctataaataagattagagatacagctacatca
catgaaagagccaatatcattgaggtaatggggagaaatgctggatacatagcactttat
gcaggacttgctggtggggcagaaatcattataatacctgaagtaaaatttgatatcgac
gaggtctgcgacaaaatatcgtatggtattaagagaggtaaattgcatcacataattgta
ttggcagaaggagtaatgagcggattagagttatcaaagatgattcaagaaaggcttcct
aagctggatttgagacatactacactaggacatatacaaagaggcggtgcaccatcggtt
atggatagaattattgcaagtcaaatgggttccagagctgttgagcttctattggagaat
aaatcacagaggataatcagcataagaaacaatcaaatagttgatgatgatattgacact
gcattagctatgagaaaagagttcaactttaagttatatgaacttagcaaaatattatca
atctag

DBGET integrated database retrieval system