KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_0773Help
Entry
Tthe_0773         CDS       T01299                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tthe_0773
Enzymes [BR:ttm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Tthe_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
796696..798804
Genome map
AA seq 702 aa AA seqDB search
MSSKLIKYLPLLVLASSVLSGCSNNVSSIKIDRFNNISAVNGPGEEDTWASAQKQGVGTA
NNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVSDETKDAISKVEKFTDK
SLGYKLVNTDKKGRYRITKEIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQG
SYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHY
DSARGNIIEGAEIDLTKNSEFEIVLSFGGSDSEAAKTALETLGEDYNNLKNNYIDEWTKY
CNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSR
DLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPII
LSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAE
QNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPNADFMINIANGG
GVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGE
PSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTG
LPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYASK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaaacttattaaatatttacctttactagtgctggcatccagtgttttaagc
ggatgttccaacaatgtgtcaagtatcaaaatagatagatttaataatattagcgcagta
aatggacctggtgaagaagatacatgggccagtgctcaaaaacagggtgtcggtacagca
aataattacgtatcaaaagtttggtttacgctggcaaatggcgccatatcagaggtgtac
tatccaacgatagatacagcagatgtaaaagaaattaaatttattgtgactgatgggaaa
tcgtttgtctcagatgaaacaaaggatgcaataagcaaggtagagaagtttaccgataag
tcattaggttataagctagtcaatacagataaaaaaggaaggtataggataacaaaagaa
atatttacagatgtaaaacgcaattctctgataatgaaagcaaagtttgaagcattagaa
ggaagtatacatgactataagctgtatcttgcatacgacccacatattaaaaatcaggga
agttacaatgaaggttatgtaataaaggctaataacaatgagatgttgatggcaaaaaga
gataacgtatatactgctttatcatctaacataggttggaaaggatattcgattgggtac
tataaagttaatgatattatgactgaccttgacgagaataagcaaatgactaagcattat
gatagtgcaaggggcaatatcatagaaggggcagagattgatttaacaaaaaacagcgaa
tttgaaatcgttctgtcatttggtggaagcgatagtgaggcagcaaaaacggccttagag
actcttggggaagattataacaatttaaaaaataactatatagatgaatggactaaatat
tgcaatactctcaataatttcaatggcaaagcaaattcactctattacaacagcatgatg
atattaaaagcaagcgaagataagacaaacaaaggcgcatatattgcatctctttcgatt
ccatggggggatggacaaagggatgacaatacaggcggctatcatctcgtatggtcaaga
gatttgtaccatgtagcgaatgctttcattgcggctggagatgttgattctgccaataga
tcgctggattaccttgccaaagtggttaaggacaatggcatgattcctcaaaatacttgg
attagtggtaagccctattggacaggcattcagctagatgagcaggcagatccaatcata
ctcagctataggctgaaaagatacgatctatatgacagtttagttaagccattggcagat
ttcataataaagatagggcctaagacagggcaagaaagatgggaagagataggtggatac
tcgcctgcaacaatggctgcagaggtagcaggacttacatgtgcagcgtatatagctgag
caaaataaagattatgagtcagcacaaaaatatcaagaaaaagcagataattggcagaag
cttatcgacaatcttacttacactgaaaatggaccactaggaaatggccaatactatatt
agaatagctggtctgtctgatccaaatgcagactttatgataaacatagcaaatggcggt
ggagtatatgatcaaaaagaaatagtagatccaagttttctggaacttgtaaggcttgga
gttaaatcggcagatgatcctaaaatattaaatacgttaaaagttgttgatagcacaatc
aaagttgatacgccaaaggggccatcgtggtacagatataatcatgatgggtatggtgaa
ccatcaaagacagaactgtatcatggcgcaggaaaaggaagattgtggcctcttcttact
ggtgagagaggcatgtacgaaattgccgcaggaaaagatgcaacgccatatgtaaaagca
atggagaagtttgcaaacgaaggtggcataatatctgagcaggtttgggaggataccggt
cttccaactgattcagcatcacctcttaattgggcacatgccgaatacgtaatattattt
gcatcaaatatagagcataaagtgctagatatgccggatattgtttataaaaggtatgct
tcaaagtaa

DBGET integrated database retrieval system