KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1016Help
Entry
Tthe_1016         CDS       T01299                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00010  Glycolysis / Gluconeogenesis
ttm00030  Pentose phosphate pathway
ttm00051  Fructose and mannose metabolism
ttm00052  Galactose metabolism
ttm00230  Purine metabolism
ttm00500  Starch and sucrose metabolism
ttm00520  Amino sugar and nucleotide sugar metabolism
ttm00521  Streptomycin biosynthesis
ttm01100  Metabolic pathways
ttm01110  Biosynthesis of secondary metabolites
ttm01120  Microbial metabolism in diverse environments
ttm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tthe_1016
   00030 Pentose phosphate pathway
    Tthe_1016
   00051 Fructose and mannose metabolism
    Tthe_1016
   00052 Galactose metabolism
    Tthe_1016
   00500 Starch and sucrose metabolism
    Tthe_1016
   00520 Amino sugar and nucleotide sugar metabolism
    Tthe_1016
  Nucleotide metabolism
   00230 Purine metabolism
    Tthe_1016
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tthe_1016
Enzymes [BR:ttm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tthe_1016
    5.4.2.8  phosphomannomutase
     Tthe_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ADL68542
JGI: Tthe_1016
UniProt: D9TN19
Position
1044434..1045804
Genome map
AA seq 456 aa AA seqDB search
MALNQNMFRMYDIRGVWNDDLTEETAELIGKAFGTYIQNEKGIKDVIVGRDNRISSKPIR
NAVVNGLTSTGCNVLDIGVLTTPAFYYSRILYNYDAGLMITASHNPPQFNGFKVAFGPST
IYGDELKKLYHIAEKGDFKTGTGFLKYAYPIQSYIKMIQDKVKLGNKKLKVVVDCGNGTC
SNIYPDIIYGLGCEVYPLYCESDPTFPNHFPDPVNADNLKDLIKEVKRLGADVGIAFDGD
GDRIGVVDEKGNIIWGDMLMVLYWREIMKKHPGADAIVEVKCSKALPEEIKKLGGNPIFY
KTGHSLIKAKMKEINAVFTGEMSGHMFFADEYYGYDDAAYAAARLLRILSNTDKTLSELL
SDVPKYPSTPELRLHCDDEKKFDVVKGVTEYFREKGYDLIDIDGARVMFDGGWGLVRASN
TGPELIVRCEADTEERLKEIKVELAEVLKKYGVELK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcactaaatcaaaacatgtttaggatgtatgatataagaggtgtatggaatgatgac
cttactgaagagacagcagagcttattggtaaggccttcggtacatatattcaaaatgaa
aaaggcataaaagacgtaattgtaggcagggacaacaggatatcatcaaagcctataaga
aatgcggtagtaaatggacttacctctactggctgcaatgtgctggatatcggtgttctg
actacgcctgctttttactattcccgcatactatataattacgacgcagggcttatgata
acagcaagccacaatccaccgcagtttaacggatttaaagttgcatttggaccgtcaact
atatacggcgatgagcttaagaagctctatcatattgcggagaaaggcgatttcaagaca
gggacaggttttttgaaatacgcatatccgatacaaagttatataaaaatgatacaggac
aaagtaaaacttggcaataaaaagcttaaagtagttgttgactgtggaaacggtacatgc
tcaaacatctatcctgatattatatatggacttgggtgcgaagtatacccgctgtactgc
gaatcagatccgacatttccaaatcactttccggatccagtcaacgcagacaatctgaaa
gacctgataaaagaggttaaaagacttggtgcagacgttggcatagcttttgacggcgat
ggagataggattggcgtcgttgacgaaaaaggcaatataatatggggcgatatgctgatg
gtgctttactggagagaaatcatgaaaaagcaccctggagcggacgctattgttgaggtt
aaatgttcaaaggcattaccggaagagataaaaaagcttggaggcaatccaatcttctat
aagactggccacagcctcataaaagccaaaatgaaagaaatcaacgctgtttttacaggt
gaaatgtcaggacacatgttctttgcagacgagtattacggctatgatgatgcggcatat
gctgcagcaaggcttttaagaatactttccaatacggataagacattatcggagcttctt
tctgatgttccaaaatatccgtcaacgccggaattgagattgcactgcgatgatgaaaag
aaatttgatgttgtaaagggcgtgacagagtatttcagagaaaagggatatgatttaata
gatatcgacggtgcaagagttatgtttgatggtggatgggggcttgtcagagcttcaaat
acaggtcctgagttgattgtaaggtgcgaagctgatacagaggaaagattaaaagagatt
aaagttgaacttgcagaagtattaaagaaatacggcgttgagcttaagtaa

DBGET integrated database retrieval system