KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1016Help
Entry
Tthe_1016         CDS       T01299                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tthe_1016
   00030 Pentose phosphate pathway
    Tthe_1016
   00051 Fructose and mannose metabolism
    Tthe_1016
   00052 Galactose metabolism
    Tthe_1016
   00500 Starch and sucrose metabolism
    Tthe_1016
   00520 Amino sugar and nucleotide sugar metabolism
    Tthe_1016
  Nucleotide metabolism
   00230 Purine metabolism
    Tthe_1016
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tthe_1016
Enzymes [BR:ttm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tthe_1016
    5.4.2.8  phosphomannomutase
     Tthe_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1044434..1045804
Genome map
AA seq 456 aa AA seqDB search
MALNQNMFRMYDIRGVWNDDLTEETAELIGKAFGTYIQNEKGIKDVIVGRDNRISSKPIR
NAVVNGLTSTGCNVLDIGVLTTPAFYYSRILYNYDAGLMITASHNPPQFNGFKVAFGPST
IYGDELKKLYHIAEKGDFKTGTGFLKYAYPIQSYIKMIQDKVKLGNKKLKVVVDCGNGTC
SNIYPDIIYGLGCEVYPLYCESDPTFPNHFPDPVNADNLKDLIKEVKRLGADVGIAFDGD
GDRIGVVDEKGNIIWGDMLMVLYWREIMKKHPGADAIVEVKCSKALPEEIKKLGGNPIFY
KTGHSLIKAKMKEINAVFTGEMSGHMFFADEYYGYDDAAYAAARLLRILSNTDKTLSELL
SDVPKYPSTPELRLHCDDEKKFDVVKGVTEYFREKGYDLIDIDGARVMFDGGWGLVRASN
TGPELIVRCEADTEERLKEIKVELAEVLKKYGVELK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcactaaatcaaaacatgtttaggatgtatgatataagaggtgtatggaatgatgac
cttactgaagagacagcagagcttattggtaaggccttcggtacatatattcaaaatgaa
aaaggcataaaagacgtaattgtaggcagggacaacaggatatcatcaaagcctataaga
aatgcggtagtaaatggacttacctctactggctgcaatgtgctggatatcggtgttctg
actacgcctgctttttactattcccgcatactatataattacgacgcagggcttatgata
acagcaagccacaatccaccgcagtttaacggatttaaagttgcatttggaccgtcaact
atatacggcgatgagcttaagaagctctatcatattgcggagaaaggcgatttcaagaca
gggacaggttttttgaaatacgcatatccgatacaaagttatataaaaatgatacaggac
aaagtaaaacttggcaataaaaagcttaaagtagttgttgactgtggaaacggtacatgc
tcaaacatctatcctgatattatatatggacttgggtgcgaagtatacccgctgtactgc
gaatcagatccgacatttccaaatcactttccggatccagtcaacgcagacaatctgaaa
gacctgataaaagaggttaaaagacttggtgcagacgttggcatagcttttgacggcgat
ggagataggattggcgtcgttgacgaaaaaggcaatataatatggggcgatatgctgatg
gtgctttactggagagaaatcatgaaaaagcaccctggagcggacgctattgttgaggtt
aaatgttcaaaggcattaccggaagagataaaaaagcttggaggcaatccaatcttctat
aagactggccacagcctcataaaagccaaaatgaaagaaatcaacgctgtttttacaggt
gaaatgtcaggacacatgttctttgcagacgagtattacggctatgatgatgcggcatat
gctgcagcaaggcttttaagaatactttccaatacggataagacattatcggagcttctt
tctgatgttccaaaatatccgtcaacgccggaattgagattgcactgcgatgatgaaaag
aaatttgatgttgtaaagggcgtgacagagtatttcagagaaaagggatatgatttaata
gatatcgacggtgcaagagttatgtttgatggtggatgggggcttgtcagagcttcaaat
acaggtcctgagttgattgtaaggtgcgaagctgatacagaggaaagattaaaagagatt
aaagttgaacttgcagaagtattaaagaaatacggcgttgagcttaagtaa

DBGET integrated database retrieval system