KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1018Help
Entry
Tthe_1018         CDS       T01299                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00040  Pentose and glucuronate interconversions
ttm00052  Galactose metabolism
ttm00500  Starch and sucrose metabolism
ttm00520  Amino sugar and nucleotide sugar metabolism
ttm01100  Metabolic pathways
ttm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tthe_1018
   00052 Galactose metabolism
    Tthe_1018
   00500 Starch and sucrose metabolism
    Tthe_1018
   00520 Amino sugar and nucleotide sugar metabolism
    Tthe_1018
Enzymes [BR:ttm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tthe_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADL68544
JGI: Tthe_1018
UniProt: D9TN21
Position
1046547..1047467
Genome map
AA seq 306 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVNSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKGKENLLNLVEDITNMVDIHYIRQKEPKGLGHAIYCAHTFV
GNEPFAVLLGDDIVDAEVPVLKQMIEQYERYNCSIIGVQEVPKSEVDKYGIVDASMIDDR
LYRVNNLVEKPKKEEAPSNMAILGRYIISPKIFDILKDLRPGAGGEIQLTDALKALLDYE
AIYAYNFEGKRYDVGDRMGFLKATIEYALKRDNLKDDLLKYLNEIVKAADKNDIEVAAYS
ENNKQK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcgataattccagcagcaggacttggaactaggtttttgcctgca
acaaaagcacagccaaaagaaatgcttccaatagttgataagccgaccatacaatatatt
gtagaagaagccgtaaactcgggtatagaagatatactcataataacaggaagaaacaaa
agagcgatagaggaccacttcgacaaatctgtagaattagaactagaattaaagaaaaaa
ggcaaagaaaatcttttaaatcttgttgaagatataacaaatatggtggatatacattat
ataaggcaaaaagagccaaagggacttggacatgccatttattgtgcacatacatttgta
gggaacgagccatttgcagttctattaggggacgatatagttgatgcggaagtacccgta
ttgaagcagatgatagagcagtacgaaagatacaactgttccataatcggcgtacaagag
gtaccaaagagtgaggtagacaaatacggcatagtagatgccagcatgattgatgacagg
ctgtatagagtaaacaacctagtagagaagccaaaaaaagaagaagcaccatcaaacatg
gccatacttggaaggtatataatatcgccaaagatatttgatatactaaaagacttaagg
cccggagcaggtggagaaatacagcttactgatgcacttaaagcgctattggactatgaa
gcaatatacgcatataattttgaaggaaagaggtatgatgtgggcgatagaatggggttt
ttaaaagcaactattgaatatgctttaaaaagagataatctaaaagatgatcttcttaaa
tatctaaatgaaattgtaaaagctgccgataaaaacgatatagaagttgcagcatacagt
gaaaataataaacagaaatag

DBGET integrated database retrieval system