KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1230Help
Entry
Tthe_1230         CDS       T01299                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tthe_1230
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tthe_1230
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tthe_1230
Enzymes [BR:ttm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tthe_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1253664..1254839
Genome map
AA seq 391 aa AA seqDB search
MIGRFGKFGGQYVPETIMSALIELEDEFYKAMKDENFINEYKYYLKEYSGRPTPLYYAEN
LSKRLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMGKKKVIAETGAGQHGVATATGA
AMFDMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVKTGTGTLKDAVNEAIRNWVTNIDD
TFYVMGSVVGPHPYPTMVRDFQRVIGDEAREQIISKENRLPDYIVACVGGGSNSMGIFYP
FINDSLVKLIGVEAAGLGIDTDKHAATMAKGSIGVLHGMMTYLLQDDEGQIMPVYSISAG
LDYPGVGPEHSYLKDSGRAQYVYATDEEALSAFMDLSQIEGIIPALESAHAVAYAMKLAS
KLSKDNIIIVNLSGRGDKDVNTVANVLGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgataggaagatttggtaaatttgggggacagtatgtgccagaaacaatcatgagtgct
ttaattgaacttgaagacgaattttacaaagcaatgaaagatgaaaattttattaacgag
tataaatattatttaaaggaatattccggaaggccgacacctctatactatgcagaaaat
ttgtcaaaaagactaggcggcgcaaaaatttatttaaaaagagaagatttaaatcacaca
ggggctcacaagataaacaatgtactggggcagattctattagctaaaagaatgggtaaa
aagaaagttatagctgagactggagcaggacagcacggtgtggcaactgcaacaggtgct
gcaatgtttgatatggaatgtgaaatctttatgggtgaagaagatataaagaggcaatca
ttaaatgtttttagaatgaaattgcttggtgcaaaagtcacgccggtcaaaaccggaact
gggactttgaaagatgccgtaaacgaggcaatacgcaattgggttacaaacattgatgat
acattttacgtaatgggatctgtcgtaggaccgcatccatatccaacgatggttagagat
tttcagagagttataggcgatgaggcaagagaacaaatcattagcaaagaaaataggttg
cctgattatattgttgcatgtgttggtggtggcagcaattctatgggaatattttaccct
tttataaatgactcattagtaaaacttataggtgtcgaggcagcaggtcttgggatagat
actgataaacatgctgccactatggcaaaaggaagcattggtgtacttcacggaatgatg
acgtatctgctacaggatgatgaggggcagataatgccggtttattcgatatccgcagga
cttgattatcctggagttggaccggagcactcgtatttaaaagatagcggtagagcccaa
tatgtttatgcaactgatgaagaagcattatcagcttttatggatctttcacaaatagag
ggaattataccggcccttgagagtgctcatgctgttgcttatgccatgaaactagcatca
aaattaagtaaagataatattattattgtaaacttgtcaggaagaggcgacaaggatgta
aatacagttgccaatgttttgggggtggaattatga

DBGET integrated database retrieval system