KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1231Help
Entry
Tthe_1231         CDS       T01299                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tthe_1231
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tthe_1231
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tthe_1231
Enzymes [BR:ttm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tthe_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1254836..1255663
Genome map
AA seq 275 aa AA seqDB search
MSALNNEMNTVASMNRIDKKFYELKQKGLKAMIPFITAGDPSLDVTVELVFKMEEGGADI
IEIGIPYSDPLADGPIIQASSTRALKNGTKINNIMNAVKKIRQKSEIPLVYLVYYNSIFK
YGIERFVNEAKESGIDGLIIPDLPLEERKDIKEISEKYGIYLIPLVAPTSKERIKSICES
GKGFVYCVSTKGVTGIRNSIETDIKEYMRTVSEYTNMPKAIGFGISGPDMAKRFAPYCDG
IIVGSAIVKMINDSRSKEEIYDNVKKFVFSIKEAI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattaaataatgaaatgaatacagttgcaagtatgaatagaatagacaagaaa
ttttacgagttaaagcaaaaaggccttaaggctatgattccttttattactgcaggtgat
cctagtttagatgtaaccgtcgaattagtgtttaaaatggaagaaggaggagctgatatc
attgaaatagggattccgtactctgatccgctggcagatggaccaataatacaagcttca
tctacaagagcattaaaaaatggtacaaaaattaacaatataatgaatgctgtcaaaaaa
ataagacaaaaaagtgaaataccgcttgtctaccttgtgtattataattcaatcttcaaa
tatggcattgaaagatttgtaaatgaagccaaagaatccggaatagacggacttataata
cctgatttgccattagaagaaagaaaagatattaaagaaatatctgaaaaatatggtatt
tatctaataccattagttgcaccaacttcaaaagagaggattaaaagtatttgtgaaagt
ggaaagggttttgtgtattgtgtctctacaaaaggcgttacaggaataagaaattctatt
gaaacagatattaaagaatatatgagaactgtatcggaatatacaaatatgcctaaagcc
ataggttttggtatctctggtcctgatatggcaaaaagatttgcaccgtactgtgatgga
ataatagttggtagtgcaattgtgaaaatgataaacgattcaagaagtaaagaagaaata
tatgataatgtgaaaaaatttgtattttccattaaagaagctatatga

DBGET integrated database retrieval system