KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1291Help
Entry
Tthe_1291         CDS       T01299                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tthe_1291
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tthe_1291
Enzymes [BR:ttm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Tthe_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1309663..1310757
Genome map
AA seq 364 aa AA seqDB search
MKIVVKVGTSTLTYENGQLNLEMMEKISRQISNLQNRGDKVILVTSGAIGAGMGKLNISK
RPKTLPEKQSLAAIGQGLLIELYEKFFNEYGKTTAQLLLTKDDFSIRDRYLNISYTLSNL
LKYNVVPIINENDTVTVDEIKIGDNDTLSALVASIIEADLLIILTDIDGLYDKDPREPDA
KLIDVVEEFTDKLFEIAGGTGTNLGTGGMYTKIQAAKICYNSGVKMVIANGKLDNVLNRI
ANGEKIGTLFMPAQNPISNRKVWIAFNAHLAGKLVIDDGAKQAILNKGKSLLPSGIISTT
GEYSVGDCVSIVDTDGREIARGLINYTSFEVNKIKGLKSTEIDKILGYKSYDEVIHRDNL
VVIS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagttgtaaaagtaggaacaagtacattgacatacgaaaatgggcagcttaat
ttagaaatgatggaaaaaatctcgaggcagatttctaatttgcaaaatagaggcgataaa
gtaatactcgttacatcaggcgcaatcggcgctggaatgggtaaacttaatatatcgaaa
agaccaaaaacgttgccagaaaagcaatcattagcagcaattggtcagggattgcttata
gagctatatgagaaattttttaatgaatacggtaaaacgacagcacagcttttgctgacg
aaagatgatttttctataagagatagatatttgaacattagttatacattgtcaaattta
ttaaagtataatgtagttcctattataaatgaaaatgacacagttactgttgatgagata
aaaataggcgataatgatacattatcagcgctagttgcaagtattattgaggcagatctt
cttattatattgacggacatcgatgggctatatgacaaggaccctagagaacctgatgca
aagttaatagatgttgtagaagaatttacagataaattgtttgaaatagcgggagggact
ggtacaaatttgggcactggtggtatgtatacaaaaattcaggcggcaaaaatctgctat
aattcaggtgttaaaatggttatagctaatggtaagcttgataatgtgttaaatagaatt
gctaacggagaaaagataggcacactatttatgccggctcaaaatccaattagcaatcga
aaggtatggatagcatttaatgcacatttggctggtaagctggttattgatgacggagca
aaacaagctatattaaataagggaaaaagtctattacctagcggcataatatctacaact
ggtgaatattctgtaggtgattgtgtatcgatagttgatactgatggtagagagattgca
agaggtttgattaattacacatcatttgaagttaataaaataaaaggattaaaatctact
gagattgataagattctagggtataaaagttatgatgaagttattcatagagacaatcta
gttgttataagttag

DBGET integrated database retrieval system