KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1351Help
Entry
Tthe_1351         CDS       T01299                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00330  Arginine and proline metabolism
ttm01100  Metabolic pathways
Module
ttm_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tthe_1351
Enzymes [BR:ttm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Tthe_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADL68865
JGI: Tthe_1351
UniProt: D9TT99
Position
1357396..1358262
Genome map
AA seq 288 aa AA seqDB search
MVIKDNFSNSGKFLSSINDYKESDIVIVGVPMDYTVSFKPGTRFGPQAIRTASLGLEEYS
VYLDRNLKEKKYYDFGDLILPYGNVEKSLDIIGNAAKEILEDGKKPLFLGGEHLISAPVI
KEVYKKYGDELVVLHFDAHTDLRTEFFGEENSHATVLRKASEFINNKNMYHFGIRSGIKE
EFEFSYKNTNMFLFNVVEPLKSVLEYIKSKPIYITWDIDVLDPAYAPGTGTPEPGGITSK
EAFNAIHILKDLNVVGMDLVEVSPDYDHSGITSILAAKLIRESILSFL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttggtaataaaagacaatttttcgaatagcggcaaatttttaagtagcattaatgattac
aaagagtcagatattgtaattgtaggcgtacctatggattatacagttagttttaaacct
ggtacacgttttggcccacaggcgataagaacagcatcattaggcttagaagaatacagc
gtttatctagatagaaatttaaaagaaaagaaatattatgattttggtgatttaatttta
ccttatggaaacgtcgagaaaagcctcgatataattggaaatgcagccaaagaaatactt
gaagatggaaaaaagccgttatttttgggaggagagcatttaataagtgctccagttata
aaagaagtttacaaaaagtatggtgatgaattggtagtacttcattttgatgcacatact
gatctaagaactgaattttttggtgaagaaaattctcatgcgactgttttaagaaaggct
tctgaattcatcaataataaaaatatgtatcattttggtatacgctctggaataaaagaa
gaattcgagttctcttataaaaatactaacatgtttttgtttaacgttgttgagccttta
aaaagtgtacttgagtatattaagtcaaaacctatttatattacatgggatatagatgtt
ttagatcctgcatatgctcctggaactggtacacccgaaccaggtggtataacatcaaaa
gaggcatttaatgcaatacacattttaaaagatttaaatgttgtcggtatggatttagtt
gaggtatcacctgattacgaccattcaggtattacttcaattttagcagcaaaacttatt
cgtgaatcaattttatccttcttataa

DBGET integrated database retrieval system