KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1544Help
Entry
Tthe_1544         CDS       T01299                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ttm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ttm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1544274..1545206)
Genome map
AA seq 310 aa AA seqDB search
MIKKDVLGIRDMSKEDLIEILDTAKEMKKIIEGEKISDILKGKTIITIFFEPSTRTRLSF
EMAAKYLGAHFGNIETKTSSVVKGESLIDTVRTVERMKADVIITRHNMSGAPHLMAKYLN
ASIINAGDGLNEHPTQALLDLMTIGEKKESFKGLKVVIIGDIVHSRVARSNMWGLLKLGA
EVRLAGPATLLPKTFEKLGVKVYYDINKAINGVDVVMGLRIQLERQKSGLFPSKDEFVRY
FGITSERMRLAKKDAILMHPGPINRNVEISSEAANSGYSVIEEQVTNGVAVRMALLKLLC
ERRKNNENNY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaaaagatgtattgggcattcgtgacatgtccaaggaagatttaatagagata
ctcgatacagcgaaagaaatgaagaaaattatagagggtgaaaaaatttcggacatctta
aaaggtaaaacaatcataacaatattttttgagcccagtactagaacaaggctatcattt
gaaatggcagctaaatatttgggtgcacattttgggaatatagagactaaaaccagcagc
gtagtaaaaggtgagtctctcattgacaccgtaaggacagtagagaggatgaaagcggat
gtgattataacacgtcacaacatgtcaggagctccgcatcttatggcaaaatatttaaat
gcatctataataaatgccggagatggcttaaatgagcatcctacacaggctctattggat
ttaatgacaataggagaaaaaaaagaatcttttaaaggattaaaggtagtcatcattggc
gatatagttcattctagagttgcaagatcaaatatgtggggacttttgaaattgggagca
gaagtgagattagcaggacctgctacattattgccaaaaacttttgaaaaattaggtgta
aaagtctattacgacataaacaaagctataaatggtgttgatgttgtaatgggacttaga
atccagctagaaagacaaaaaagcggattatttccatcaaaagatgagtttgtcagatat
tttggcattacatctgaaaggatgagacttgctaaaaaggatgccatattgatgcatcca
ggaccaattaacagaaatgtagaaatttcatccgaagcagcaaattcagggtattcggta
attgaggagcaagtaacaaatggtgtagcagttagaatggcacttttaaaattattatgc
gaaaggagaaaaaataatgaaaacaattattaa

DBGET integrated database retrieval system