KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1595Help
Entry
Tthe_1595         CDS       T01299                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tthe_1595
Enzymes [BR:ttm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tthe_1595
Exosome [BR:ttm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tthe_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1586801..1587775
Genome map
AA seq 324 aa AA seqDB search
MELLKRPRRLRANEVIRRMVKETSISVDDLIYPMFVVPGENIKEEIDVMPGVYRYSVDNL
VKEVKEVYDLKIPAVLLFGIPSKKDELGSEAYDDDGIVQKAVKSIKESIPQMIVITDVCM
CEYTSHGHCGIIRNGYVQNDETVSYIAKIALSHVKAGADIVAPSDMMDGRIKAIRNILDE
NGYVNTPIISYSAKYASAFYGPFREAANSAPQFGDRKSYQMDPANSDEALREISLDIDEG
ADIIMVKPALPYLDIIRRAKDTFNVPIAAYNVSGEYSMIKAASQMGYINEKSTVLESLTG
IKRAGADIIITYFAKDVAKWLTIL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaattactaaaaaggcctaggaggcttagagcaaatgaagttataagaagaatggta
aaggaaacgtctataagcgtagatgatttgatatatcctatgtttgttgtgcccggtgaa
aatataaaagaagaaattgatgtaatgcctggagtctatcgttattctgtagataacctt
gtaaaagaggtcaaagaagtatatgatttaaaaataccagccgtcctgctttttggcata
ccatcaaagaaagatgaattaggttctgaagcatatgatgatgatgggatcgtacaaaaa
gctgtaaaatctataaaggagtcaattccgcaaatgattgtcataactgatgtatgtatg
tgcgagtatacaagccacgggcattgtggaattataaggaacggctatgtacaaaatgac
gagacagtttcatacatcgcaaaaatagcattgtcacacgtcaaggcaggtgcagacatt
gtagccccatcagacatgatggatggacgcataaaagcaataagaaatatcttagatgaa
aatggttatgtaaatacgccaataatatcctacagcgctaaatatgcatcggcattctat
ggtcctttcagagaagcagccaattcagcacctcaatttggagataggaagtcataccaa
atggatcctgcaaactctgacgaagctttaagagaaatttcacttgacatagacgaaggt
gctgacataataatggttaaacctgcactgccgtatcttgatataataagaagagcaaaa
gacacattcaatgtccctatcgcagcatacaacgtaagcggtgaatactcaatgataaaa
gccgcatctcagatgggctatataaacgaaaaatctacagttttagaatctttgacagga
ataaaaagagcaggcgccgatatcataataacgtactttgctaaggatgttgcaaaatgg
cttactatcctataa

DBGET integrated database retrieval system