KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1726Help
Entry
Tthe_1726         CDS       T01299                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tthe_1726
Enzymes [BR:ttm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tthe_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1719496..1720443)
Genome map
AA seq 315 aa AA seqDB search
MKNILVVGSINMDIVIKVEHIPKIGETVIAKEVNYSFGGKGANQAVAIAKLGGNVTMIGR
VGDDNFGKELIENLDKQKVKPSGIEIDKTEKTGMAFIYVSDKGENNISVNQGANKKLDVE
QINRHLDLFDAAEICVLQLEIPIETVKYAIEICNKKNIKVILNPAPARKIPEEILKNIYI
LTPNESELSILTKKNVKTIEDINNASEILLESGVQNIITTLGEKGCFLKNKNDSLHFAAV
QVDAIDTTAAGDSFTGAISIALNNGKSIKEAIEFATYVSALTVTKEGTQDSLPDKLEVEK
FINERREVHEKNNFA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattttagtagttggaagtattaatatggacattgtaataaaagttgagcat
ataccaaagattggtgaaactgttattgcaaaagaagtaaactattcatttggagggaaa
ggtgcaaatcaagctgtcgcaatagctaaattaggtggaaatgttactatgataggcaga
gttggagacgataactttggcaaagaactgattgaaaatttagataaacaaaaagtaaag
ccaagtggcattgaaatcgataaaacagaaaaaaccggtatggcatttatatatgttagt
gataaaggtgagaacaatatatctgtaaatcaaggagcaaataaaaaattagatgttgaa
caaataaatagacatttagacttgtttgatgcagccgaaatttgtgtattacaattagaa
attccgattgaaacagtaaaatacgctattgagatttgcaacaaaaaaaatataaaagtc
atattgaatccagcgcctgccagaaaaatacctgaagaaatattgaaaaatatatatatt
ttaacgccgaatgaaagtgaattgtcaattttaactaagaaaaatgtaaagactattgaa
gatattaacaatgcatctgagattttattggaatcaggagtacaaaacataataacgact
ttaggagaaaaaggatgctttttaaagaataaaaatgattctttacattttgcagcagta
caggtagacgctatagatactacggcagcaggtgattcttttactggtgctatatcaatt
gctttaaataatggtaaaagcataaaagaagctattgagtttgcaacttatgtttctgct
ttaactgtaacaaaagaaggtacacaggattctttgccagataagttagaggttgaaaaa
tttattaatgagaggagagaagttcatgaaaaaaacaactttgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system