KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1771Help
Entry
Tthe_1771         CDS       T01299                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ttm00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ttm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1764089..1765543)
Genome map
AA seq 484 aa AA seqDB search
MRLADVLKDIEYTIVKGNVDVDIRGICYDSRNSKDGSMFVAIKGFKSDGADYIGDAIERG
AVAVLVDGEISIDKDITLIKVQNTRKSLAKIASNYYGDPSKQLFLIGVTGTNGKTSVTYM
IKSILESQNNKVGLIGTIQNMIGDKVYPTERTTPESLDLQRYLRLMVDEGVKYVVMEVSS
HSLALNRVDECDFDIAVFTNLTQDHLDFHKTMDDYANAKAKLFRMAKTACVINIDDDYSS
LIIENSNAKVVTYGIKDYAYIMAKDIKNDIKGAKYTVQIEDIKSDIALKIPGLFSVYNSL
AAISVAFILGIPLQSVKIALKDVKIKGRFEILDIDAPYNVVIDYAHTPDGLENLMKAFGE
YDTGRKILLFGCGGDRDKGKRPKMGEVAGKYADFVIITSDNPRSEDPMQIISEIEMGIKN
TKCPYKIIENRKEAIKYALSIAKDNDIVILAGKGHETYQVLKDRVIDFDEREIVKEILNG
DEKN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacttgcagatgtattaaaagatattgaatatacaattgtaaaaggtaacgtcgat
gtggatataaggggtatatgttacgattcaagaaattcaaaagatggttcaatgtttgta
gcaatcaaaggatttaaatctgatggcgcagattacataggtgatgctattgaaagaggg
gcagtagctgtcctggtagatggcgaaatcagcattgataaagatattacgctgataaaa
gttcaaaatactaggaagtcattagcgaagattgcctccaattattatggtgatccatca
aagcagctttttttgataggtgtaacaggtacaaatggtaagacttctgttacatacatg
ataaaatctatactagaaagccaaaacaacaaggtaggcttaataggtacaatacaaaat
atgataggcgataaagtttatccaacagagcgaacaacccccgaatctttagatttgcaa
aggtatcttagactgatggtagatgaaggtgttaagtatgtagtgatggaagtttcatca
cattcattggcattaaacagggtggatgagtgcgattttgacattgctgtttttacaaac
ttgacacaagaccatttagactttcataagacaatggacgactatgccaatgcaaaagca
aaactttttagaatggcaaaaacagcgtgtgtaatcaatattgatgatgattattcttca
ttaataatagaaaactctaatgctaaagttgtaacatatggtataaaagattatgcttac
ataatggcaaaagacataaaaaatgacattaaaggtgctaaatatactgttcaaatagaa
gatataaaaagcgatatagctttaaaaattcccggtttatttagcgtgtacaattcgctg
gcggccatttctgtggcatttattcttggcataccgcttcagtctgtaaaaatcgcgttg
aaagatgttaaaataaaaggtagatttgagattcttgacatagatgcgccatacaatgta
gtgattgattatgctcatacacctgatggtttggaaaatttaatgaaagcatttggtgag
tacgatacaggaagaaagatattgctctttggttgcggtggcgatagagataaaggtaaa
agaccaaaaatgggggaagtcgcagggaaatatgcagattttgtaattataacatcagat
aatccaagatcagaggatcctatgcagataataagtgaaattgaaatggggataaaaaat
acaaaatgcccttacaagattattgaaaatagaaaagaagcaataaaatatgctctgtct
atagcaaaagataatgacattgttattctggcaggtaaagggcatgaaacgtatcaagtt
ttaaaagatagagttatagattttgatgaaagagagatagtaaaagagatattaaatgga
gatgaaaaaaattga

DBGET integrated database retrieval system