KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1921Help
Entry
Tthe_1921         CDS       T01299                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ttm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1905372..1906838)
Genome map
AA seq 488 aa AA seqDB search
MALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGDRGFAPITYSEI
EPKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKD
GKPVKGDIEKMFLRRTLPYSTFKIEETGEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLL
EVFKTFSNFGVKIVRLDAVGYVIKKIGTSCFFVEPEIYEFLDWAKGQAASYGIELLLEVH
SQFEVQYKLAERGFLIYDFILPFTVLYTLINKSNEMLYHYLKNRPINQFTMLDCHDGIPV
KPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDVHQINCTYYSALNCDDDA
YLAARAIQFFTPGIPQVYYVGLLAGVNDFEAVKKTKEGREINRHNYGLKEIEESVQKNVV
QRLLKLIRFRNEYEAFNGEFFIEDCRKDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINEN
GEEVKYLV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
ttggcacttaaaaataaggtacaactcataacatatcctgactctttgggaggaaattta
aaaactttaaatgatgtcttggaaaaatatttttctgatgtatttggtggtgtccacatt
ttgccgccttttccatcatccggtgatagagggtttgcacctataacatacagtgagata
gaacctaaatttggaacatggtacgacattaagaaaatggctgaaaattttgacattctt
ttggatttaatggttaatcatgtatccagaagatctatttattttcaggatttcttaaaa
aaaggtagaaaatcagaatacgctgatatgtttattacattagataaactttggaaggat
ggaaaacctgtcaaaggcgacatagaaaaaatgtttttgagaaggactttgccatattcc
acatttaaaatagaagaaacaggagaagaagaaaaagtctggaccacctttggtaaaacg
gatccatctgagcaaattgatttggatgtcaactcacatttagtgagagaatttttatta
gaagtttttaagacatttagcaattttggagttaaaatagtgagacttgatgcagtaggg
tatgtaataaaaaaaattggaactagctgcttttttgtcgaaccggagatatatgaattt
ttagactgggcaaaaggacaagcagcttcttacggaatagaactgcttttggaggtacat
tcgcaatttgaagtacaatacaaattagcagaacgtggctttttgatttatgattttatt
ttgccatttactgttctttatactttaataaataaatcaaacgaaatgttgtatcattat
ctaaaaaaccgtcccattaatcaatttacaatgttggattgccacgacggaattcctgta
aagcctgatttggatggacttattgatacgaagaaggctaaggaagtagtcgatatatgt
gtgcaaagaggtgctaatctaagtctaatatacggagataaatataaatcagaagatggc
tttgatgtgcatcaaattaattgtacgtattattcagcattaaattgtgatgatgacgca
tatttggcagccagagccattcaattctttacaccaggtataccacaagtctattacgta
ggccttttagctggagtaaatgactttgaagcagtaaaaaagactaaagaagggcgagag
ataaatagacacaactatggtttaaaagaaatagaggaatcagttcaaaaaaatgtagtt
cagagattgttaaaattaatcagatttagaaatgaatacgaggcatttaatggtgaattt
tttattgaagattgccgaaaagatgaaattaggcttacttggaaaaaagatgataaacgt
tgtagtttgtttatagatttaaagacatataagacaactattgactatataaacgagaac
ggtgaagaagtaaagtatttagtataa

DBGET integrated database retrieval system