KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_1983Help
Entry
Tthe_1983         CDS       T01299                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ttm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1975702..1977621
Genome map
AA seq 639 aa AA seqDB search
MCGICGFSGDMANYLGENNLREMLDIIIHRGPDDEGTYFKNYTALGMRRLSIIDLKSGHQ
PIHNEEKDIYVVFNGEIYNFQSLRTDMIIKGHKFYTSSDTEVIVHLYEEYGDEFVSYLNG
MFAICIWDEKNRKLLLARDRLGIKPLYYTFKNNTIIFGSEIKSLLKCKIVDAELNYSKIG
ALLSYRYVPGTETMFKDIFEVMPGNILIYSNKKFKIKKYWDIEFKDNPDIGEEFYYANKT
LTLIDSSISKRIVSDVPIGIFLSGGLDSTIILSEVSKFYDKTIKTFSVGFEKPKSKTDIN
DYSELALSKRTANYYGTEHYEFIIKPDDVINDIKNIIWYMDEPLSDPTAIPLYYLSKLAK
NYVKVVLSGEGADEIFAGYTVYKEPYAVNKYNQMPKFLKDLIESLSSRMPTNFGKDFLRR
AKLPISKRYRGVGMTFKDDEISTLLSGDLYALWLKDMKNDKYLNSFYHMPQWKDEVSQML
YFDQKVWLPKDVLIKSDKMTMANSIELRVPFLDYRIVEFASSIPSSLKYRGNNEKYILKK
AFKDTLPSFVLNRKKNGFPVPLSSLLNLEFKNFAKDILLSQKSLSRGYFNKQYIENLFKK
YNSTSYKGRQIWLLLTFELWNRIFIDSSNASLDEEMSVI
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatatgtggattttctggagatatggcaaattatctgggcgaaaataattta
agagaaatgttagacatcattattcatagaggacctgatgatgaaggtacttattttaaa
aattatacagctttaggcatgaggagattaagtataattgacttaaaaagcggacatcaa
ccaatccacaatgaagaaaaagatatatatgttgtatttaatggtgaaatatataatttt
caaagtttgagaacagacatgataataaaagggcataaattttatacatcgtcagataca
gaagttattgtacatctatacgaagaatatggtgatgaatttgtatcataccttaatgga
atgtttgctatttgtatatgggatgaaaaaaacaggaaattgcttcttgcaagagataga
cttggcataaagccactttattatacttttaagaataatacgattatatttggatctgaa
ataaaatcactactaaaatgtaaaattgtcgatgcagaattaaattacagcaaaatcgga
gcattactttcatataggtatgtacctggtactgaaacaatgtttaaggatatatttgaa
gttatgccaggaaatatattaatatatagcaataaaaaatttaaaataaaaaaatactgg
gatattgaatttaaagataacccagatataggcgaagaattttattatgcaaataaaaca
ttaactttaattgattcatccattagtaaaagaatagtaagcgacgtacctataggaata
tttttaagcggagggctcgattccaccataatattatcagaagtgtcaaaattttatgat
aaaactataaagacattttctgttgggtttgaaaagccaaaatcaaaaactgatataaac
gattattctgaattggctctttcaaaaagaactgcaaattattatggtacagaacattat
gaatttatcataaaaccagatgatgtaataaacgatattaaaaatattatttggtatatg
gatgaaccattaagtgatccaacagcaataccattgtattatttatcaaagcttgcaaaa
aattatgtcaaagtcgtattatctggcgaaggggctgacgaaatatttgctggatatacc
gtatataaagaaccttatgctgtaaataagtataatcaaatgccaaaattcttaaaagat
ttaatagaatcactaagttctagaatgccgactaattttggaaaggactttttaaggcga
gcaaaacttcctatctcaaagagatatagaggggtcggtatgacctttaaagatgatgaa
atatctacattattaagtggagatctatatgcattatggttaaaggacatgaaaaatgat
aaatatttgaattcattttatcatatgccacaatggaaggatgaagttagccaaatgttg
tactttgatcaaaaggtatggctgccaaaagatgttcttataaagtcagataagatgaca
atggcaaattcaatagaattgcgtgttccttttcttgattatagaatagttgaatttgct
tcatcaataccatcaagtctaaagtatagaggtaataatgaaaaatatatattaaagaag
gcatttaaagatactttgccaagttttgtattgaatagaaagaaaaatggattccccgtt
ccattaagctcattattaaatttagagtttaaaaattttgcaaaggatattttgctttct
cagaaatccctctctagaggttatttcaataagcaatatatcgaaaatctttttaaaaag
tataatagcacaagctataaaggaagacaaatttggcttcttttgacttttgaattgtgg
aatagaatatttatcgacagcagtaatgcttcattagatgaagaaatgtctgtaatataa

DBGET integrated database retrieval system