KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_2200Help
Entry
Tthe_2200         CDS       T01299                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tthe_2200
Enzymes [BR:ttm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Tthe_2200
DNA repair and recombination proteins [BR:ttm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Tthe_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 HHH_5 AAA_11 Helicase_RecD PhoH HHH_2 PIF1 HHH UvrD_C DUF2075 AAA_22 AAA ArgK T2SSE NTPase_1 AAA_23 AAA_28 RsgA_GTPase AAA_12 ABC_tran ATPase UvrD-helicase AAA_29 DUF5424 AAA_18 ATPase_2 AAA_14 AAA_16 FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: ADL69677
JGI: Tthe_2200
UniProt: D9TRZ8
Position
complement(2195364..2197577)
Genome map
AA seq 737 aa AA seqDB search
MVEIVGTVEEIIFKNEQNGYAVLELNSKTDSITVVGYMPYVGIGETLKIEGEWMTHPDYG
EQVKVSKYEMIAPSSLYGMERFLSSGLIRGIGPVMAKKIVSKFGLDSLNIIETHPEKLME
IPGIGEERVKMITESYEKQKGLRDVMVFLQGYGISTTNAIKIYKQYGDDSINLIKQNPYR
LSDEIFGIGFRTADKIAFAMGVDAHSSYRVSSGTKYVLMQYAANGHTYVPLDLLSRETAK
LLDASEEEVNDSLVLLAQSGKVMFETFEDGSHGVYYIPYFTAENNTADKIMNMTLTDVKP
GDIDIKNEISKIEADMGIKLADNQRLAVEESVKNSILVITGGPGTGKTTIINFIIRLFMK
FGKSVALAAPTGRAAKRMTEATGFEAKTIHRLLEYSYTEEEGRGFGKDDKNPLSEDVIII
DEASMIDILLMNALLKAIPLSSRLILVGDVDQLPSVGAGNVLRDIIDSGLVKVIRLNKIY
RQGKESLIVVNAHKINNGEYPILNDRENDFFFINAATQEEILKIILDLNKRRLPEAYGFN
PFLDIQVLSPMRKGLIGMINLNNELQKCLNPPKKGLNERQMKDFTFRVRDKVMQIKNNYK
MKWIKGDEKGEGVFNGDMGIIESIDNDAQELTVLFDDDKRATYDFADIDELSLSYCVTVH
KSQGSEFPAVIMPMSYGPPMLLTRNLLYTAVTRAKKLVVIVGQEKYLKNMIDNNLISKRY
SGLLPKLKKALRFMIEN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaatagtaggtacagttgaggagataatatttaaaaacgagcagaatggatat
gctgtattagagcttaattctaaaacagattctattaccgttgtgggctatatgccgtac
gtgggaatcggtgagactttaaagattgaaggagaatggatgacgcaccctgattatggg
gaacaggtaaaagtatcaaagtatgaaatgatagcaccctcatcattgtatggcatggag
agattcctatcatcggggcttataagaggcataggacccgttatggcaaagaagattgtt
tcaaaatttggactcgattcacttaatataatagagacacatcctgagaagttaatggaa
ataccgggtataggcgaagaaagagtcaagatgataactgagtcttatgaaaagcaaaag
ggtttaagagatgtgatggtgtttttgcaggggtacggtatatctaccacaaatgccata
aaaatttacaaacagtatggcgatgattcaataaatcttataaagcaaaacccgtacagg
ttatctgatgagatatttggaattggatttaggactgccgataaaatcgcttttgcaatg
ggggttgatgcacattcaagctacagagtttcatcagggacgaaatacgttttaatgcag
tacgctgcaaatggacatacatatgtacctcttgacttattatcaagggaaacggctaaa
ctccttgatgcatctgaagaagaagtgaatgattcccttgtgcttttggctcagagcggc
aaggtaatgtttgaaacatttgaggatggatctcacggtgtttattatataccatatttt
acggcagaaaacaatacagcagataagataatgaatatgacattgacagatgtgaagcct
ggtgacatcgatataaaaaacgaaatatcgaagatagaagctgatatgggtattaagctt
gcagataatcagaggcttgcagttgaagagtctgtaaaaaattcaatcctagtaataacg
ggaggacctggcacaggaaaaaccacgataataaatttcataataaggctatttatgaaa
tttgggaaatcagttgctcttgctgctccaacgggtagagctgcaaaaagaatgactgag
gctacaggctttgaagcaaagacaatacaccgcctccttgaatattcttacacggaggaa
gagggcagaggatttggtaaagacgataaaaatccattatctgaggatgtcatcataatt
gatgaagcatctatgatagacatattgctgatgaatgctttgcttaaggcgattccctta
agctctagattaatacttgtgggagacgttgatcaactgccatctgtaggagccggcaat
gttttgagggatataatagatagtggtttagttaaggtaataaggcttaataaaatatac
aggcaaggtaaagaaagtctaattgtagtaaatgcacataagataaacaatggtgaatat
cccatattaaatgatagagaaaatgattttttctttataaatgctgctacacaagaagaa
atattgaagataatattggatctcaacaaaagaaggctgccggaggcttatggctttaat
ccttttttagacatacaggttttaagtcccatgagaaagggtttaatcggtatgataaat
ctcaacaacgagctgcaaaaatgtcttaatccaccaaaaaaaggattgaatgaaaggcaa
atgaaggattttaccttcagagtcagagacaaagtcatgcagataaagaataattacaag
atgaagtggataaaaggcgatgaaaaaggcgaaggcgtcttcaatggcgatatgggaatc
attgagtcaatagataatgatgcacaggaactcaccgttttatttgatgatgataagcgg
gctacttatgattttgcagacattgatgaattgagcctttcctactgtgttactgttcat
aagagccaaggcagcgaatttccggctgtaatcatgccaatgagctatggcccaccaatg
cttttaacaaggaatcttttgtatacggctgtaactagggcaaaaaaacttgttgtcatc
gtgggacaagaaaaatatttaaaaaacatgatagacaataatctcatatcaaagagatac
tccggacttttgccaaagcttaaaaaggcgcttagattcatgattgagaattaa

DBGET integrated database retrieval system