KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_2521Help
Entry
Tthe_2521         CDS       T01299                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tthe_2521
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tthe_2521
Enzymes [BR:ttm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tthe_2521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2538127..2539521)
Genome map
AA seq 464 aa AA seqDB search
MILDQYVDILKDELVRSTQEIIKIKSTEGEPKPGMPYGEGPGKALEKALMIADNLGFKTK
NVDGYVGYAEYGEGDEIVGVLGHLDVVPEGDGWDYPPYGAEIHDGKIYGRGATDDKGPIM
ASLYALKAIKDSGLKLSKRVRILFGTNEETGSKEIEYYLKHEEAPTIGFTPDANYPVIYA
EKGITIFNVVKDFKEKSDELAIKYIKGGNRPNMVPDYCECAIVVKDEKRRESIPDEVKRF
RDVTGFDIDCGIENDMLVIKSHGESAHGSLPYLGKNAIMQLILFLNVIYQQDDDVKKFID
FFAKNVGLETNGKTFGVNLKDDTGELSFNVGTINLNEEKGTIGLNIRYPVTFKYEDLMNP
FNEKIGEYGMRVENMMHQPPLYFPKDHFLIKTLMKVYEDVTGRKDEPLSIGGGTYAKEMK
NMVAFGPIFPGKPDLDHQANEYIEIDDLVLNAKIYARAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatcagtatgtagatattttaaaggacgagttggtgaggtctacacaggaa
attataaaaataaagagcactgaaggggagccgaagccagggatgccgtacggagaagga
ccaggaaaagctttagagaaagctctcatgattgccgataatcttggatttaagacgaaa
aatgtcgatggatatgtgggctatgctgagtacggtgaaggagatgaaatagtaggagtt
cttgggcatttagacgttgtcccggaaggtgatggatgggattatcctccatatggtgct
gaaatacacgatggcaaaatatacggcagaggagcaacagatgataagggcccaattatg
gcttctctttacgctttaaaggcgatcaaagattccggtcttaaattaagtaagagagta
aggatattgtttggcacaaatgaagaaacgggttcaaaagagatagaatactatctaaag
catgaggaagcacctacaataggttttactccagatgcaaattatccggtcatttatgca
gaaaaaggcatcacaatatttaatgttgtaaaagattttaaagaaaagtctgatgaattg
gctattaagtacataaaaggcggcaataggccaaacatggttcctgattattgtgaatgt
gcaatagttgtcaaagatgaaaagcgaagagaaagtattccagatgaagtaaaaagattt
agagatgtgacaggctttgatatagattgcggtattgaaaatgacatgcttgtcattaag
tctcacggagagtctgcacatggaagtctcccctatcttggcaagaatgccataatgcag
cttatattgtttttaaatgttatttatcagcaagacgatgatgtgaagaaattcatagac
ttttttgcgaaaaatgtagggcttgaaacaaatggcaagacatttggagtaaatttgaaa
gatgacacaggagagctttcgtttaatgtcggcacaattaatttaaatgaggagaaaggc
accattggactaaatataagatatccggttacatttaaatacgaagacctgatgaatcca
tttaatgagaaaataggagaatacggcatgagagtagaaaacatgatgcatcagccgcca
ctttatttccctaaagatcatttcctcataaagacgcttatgaaagtctatgaggatgtg
acaggaaggaaagatgagccgttgtcgattggtggtggaacgtacgccaaagagatgaaa
aacatggtggcatttggaccgattttcccgggcaaaccggaccttgaccatcaagccaat
gagtacattgagatagatgatctcgtcttaaatgctaagatatatgcccgtgccatatac
gagctggcaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system