KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_2598Help
Entry
Tthe_2598         CDS       T01299                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00260  Glycine, serine and threonine metabolism
ttm00750  Vitamin B6 metabolism
ttm01100  Metabolic pathways
ttm01110  Biosynthesis of secondary metabolites
ttm01120  Microbial metabolism in diverse environments
ttm01230  Biosynthesis of amino acids
Module
ttm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tthe_2598
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tthe_2598
Enzymes [BR:ttm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tthe_2598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADL70050
JGI: Tthe_2598
UniProt: D9TM75
Position
complement(2622708..2623763)
Genome map
AA seq 351 aa AA seqDB search
MEWDGIIKSYRSHMPKIDDENIITLKEGNTPLIEALNLAKKLPGLKIYLKYEGLNPTGSF
KDRGMTVAVSMAKQEGSRAVVCASTGNTSASAAAYAAKAGLKCIVLIPGGKIALGKLAQA
IAYGAEVIAINGNFDDALNLVREISKKHPITVVNSINPYRLEGQKSSSFEICDTLKKAPD
YLALPVGNAGNITAYWMGFKEYYSAGVINKLPKMIGFQAAGAAPIVENRVIEHPETIATA
IRIGNPASWQKAVAARDESGGLIDKVTDDEILEAYSLLAKSEGIFAEPASCAPIAGVIKK
YREGLFKEGDTVVCILTGNGLKDPDTAIKLGGSSVKTVDADLKSLEGAIYG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggatggaataatcaaatcatacagaagccacatgcctaaaatagatgatgaa
aatataatcacgttgaaagaaggaaatacgccccttatagaagctttaaatcttgcaaaa
aagcttcctgggcttaagatatacttaaaatacgaagggctaaaccctacaggttcattc
aaagataggggaatgactgttgctgtgtccatggcaaagcaggaagggtcacgggctgtt
gtgtgtgcatcaacaggcaatacatctgcatcagcggctgcatatgctgcaaaggcaggg
cttaaatgtattgtcttgattccaggggggaaaattgcattaggcaaactagcacaggct
attgcatacggagcagaagttattgcaataaatggcaactttgatgatgcgcttaattta
gtgagggaaatatcaaaaaagcatcctataactgtcgttaattctataaatccgtataga
cttgaagggcagaagtcatcatcatttgaaatatgcgatacattaaaaaaagctcctgat
tatctggcacttcctgtaggcaatgcagggaatataacagcatactggatgggatttaaa
gagtattacagtgctggcgttataaataaacttcctaagatgatagggtttcaagcagca
ggtgcagctcctattgtagaaaacagagtaattgagcatcctgagacaatagctacagcc
ataagaatcggaaatcccgccagctggcaaaaggccgtagcagccagagatgaatcaggg
ggacttatcgacaaggttacggatgatgagatacttgaagcttactcgcttcttgccaaa
agcgaaggaatatttgctgagcctgcatcatgcgcacccattgcaggcgtcataaaaaag
tacagagaaggtctatttaaagaaggagacacggtagtctgcatacttacaggaaacggc
ttaaaggatcctgatacggctataaaactcggaggaagcagtgtaaagacagttgatgcg
gatctaaaatcattggaaggtgcaatatatggataa

DBGET integrated database retrieval system