KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_2646Help
Entry
Tthe_2646         CDS       T01299                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tthe_2646
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tthe_2646
   00620 Pyruvate metabolism
    Tthe_2646
   00650 Butanoate metabolism
    Tthe_2646
  Lipid metabolism
   00071 Fatty acid degradation
    Tthe_2646
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tthe_2646
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tthe_2646
   00626 Naphthalene degradation
    Tthe_2646
Enzymes [BR:ttm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tthe_2646
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tthe_2646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2671939..2674518
Genome map
AA seq 859 aa AA seqDB search
MATAKMETDVQKQIDLLVSKAQEAQKKFMSYTQEQIDAIVKAMALAGVDKHVELAKLAYE
ETKMGVYEDKITKNLFATEYVYHDIKNEKTVGIINENIEENYMEVAEPIGVIAGVTPVTN
PTSTTMFKCLISIKTRNPIIFSFHPKAIKCSIAAAKVMYEAALKAGAPEGCIGWIETPSI
EATQLLMTHPGVSLILATGGAGMVKSAYSSGKPALGVGPGNVPCYIEKSANIKRAVSDLI
LSKTFDNGVICASEQAVIIDEEIADEVKKLMKEYGCYFLNKDEIKKLEKFAIDEQSCAMS
PAVVGQPATKIAEMADFKVPDGTKILVAEYEGIGPKYPLSREKLSPILACYTVKDYNEGI
KKCEEMTEFGGLGHSAVIHSENQDVINEFARRVRTGRLIVNSPSSQGAIGDIYNTNTPSL
TLGCGSMGRNSTTDNVSVNNLLNIKRVVIRKDRMKWFKIPPKIYFESGSLQYLCKVKKKK
AFIVTDPFMVKLGFVDKVTYQLDKANIDYEIFSEVEPDPSVDTVMNGVKIMNSYNPDLII
AVGGGSAIDAAKGMWLFYEYPDTEFETLRLKFADIRKRAFKFPELGKKALFIAIPTTSGT
GSEVTAFAVITDKKRNIKYPLADYELTPDIAIIDPDLTKTVPPSVTADTGMDVLTHAIEA
YVSVMASDYTDALAEKAIKLVFEYLPKAYKNGNDEVAREKMHNASCMAGMAFTNAFLGIN
HSMAHILGGKFHIPHGRANAILLPYVIKYNAEKPTKFVAYPQYEYPKAAERYAEIARFLG
LPASTVEEGVESLIEAIKNLMKELNIPLTLKDAGINKEQFEKEIDEMSDIAFNDQCTGSN
PRMPLTKEIAEIYRKAYGA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcaaaaatggaaacggacgttcaaaagcaaatagatttacttgtatcaaaa
gctcaagaagcccagaagaaattcatgtcctatacacaggagcaaatagacgcaatagta
aaggcaatggccttagcaggcgtagataaacacgtggaactggcaaagctagcatatgaa
gagacaaaaatgggcgtatatgaagataagattacaaaaaatctctttgcaacagagtac
gtatatcacgatataaaaaatgaaaaaactgtaggcataattaatgaaaacatagaagaa
aattacatggaagtagcagagccaataggagtcattgcaggtgtcacacctgttacaaac
ccaacatccacaacaatgtttaaatgcttaatatccataaagacaagaaatcctataata
ttcagctttcatccaaaggctataaaatgcagcatagcggctgctaaagtaatgtatgaa
gctgcattaaaggcaggtgcacctgaaggttgtataggctggatagaaacaccgtcaatt
gaagcgacacagcttctcatgacacatccaggtgtctcattaatccttgccacaggcggc
gcaggaatggttaaatcagcatacagctcaggcaaaccagcattaggcgtaggtcctggc
aatgttccgtgctacattgagaaatcagcaaacataaagagagctgtatcagacctcatc
ttaagtaagacatttgataacggagtaatatgcgcatcagagcaagctgtaataatagac
gaagaaatagcagatgaagtaaagaagcttatgaaggagtacggctgctacttcttaaat
aaagacgagataaagaaacttgaaaaatttgcaattgatgagcagagctgcgcaatgagc
cctgcagtcgtaggtcaaccggcaacaaagattgctgaaatggcagattttaaagtccct
gacggcacaaagatattagttgcagaatacgaaggtataggtccaaagtatccgctgtca
agagagaaattaagccctatacttgcttgctacactgttaaagactacaacgaaggaatc
aaaaagtgcgaggaaatgactgaatttggaggtttaggacactccgctgtaatacactct
gaaaatcaagacgtaataaacgaatttgcaagaagagtccgcacaggaagacttatcgta
aattcaccatcatcgcagggagcaataggagatatatacaatacaaacacgccatcactt
acattgggctgcggttctatgggaagaaactcaacaacagacaacgtaagtgtcaataac
cttttaaatattaagcgtgttgtgataaggaaggatagaatgaaatggttcaagattcca
ccaaagatttactttgaaagcgggtcactgcagtatctgtgcaaagtaaagaagaaaaaa
gcctttatcgtcacagatccattcatggtaaagcttggctttgtagacaaagtgacatat
cagttagataaggcaaatatcgactacgaaatattctcagaagttgagccagacccatct
gttgatacagttatgaacggcgtaaaaatcatgaattcatacaatcctgatctgataata
gctgtaggcggcggatctgcaatagacgcagctaaaggaatgtggcttttctacgaatat
cctgatactgagtttgaaacgctgaggcttaaatttgcagacatcagaaagagagcattt
aagttcccagagcttggcaaaaaagcattattcatagcaatacctacaacaagcggcaca
ggctcagaagtcaccgcattcgctgtaataacggacaaaaagagaaatatcaaatatcca
ctggcagactatgaattaacacctgatatagcgataatagatcctgaccttacaaagaca
gttccaccgtctgtaacagcagatacaggtatggacgtcctgacacacgctatagaagca
tatgtgtctgttatggcttcagattatacagatgcactggcagaaaaagcgataaagctc
gtatttgaatacctgccaaaagcatacaaaaacggcaatgatgaagtagcccgtgaaaag
atgcataatgcttcctgcatggctggtatggcatttacaaatgcattcttaggaataaac
cacagtatggcacacatactaggcggtaagttccacataccacacggaagagccaatgct
atacttctcccatacgtcatcaaatacaatgcagaaaagcctacaaagtttgtagcatat
ccgcaatacgaatatccaaaggcagcagaaagatatgctgaaatcgccagattcttagga
ctgcctgcatcaaccgttgaagaaggcgtagaaagcttaattgaagctataaagaatctc
atgaaagagcttaatattccactgactcttaaggacgccggcatcaataaagaacaattc
gagaaggaaattgacgagatgtcagacatcgcatttaatgaccagtgcacaggctcaaat
ccgagaatgcctcttacaaaagaaatcgcagagatctacagaaaagcatacggtgcataa

DBGET integrated database retrieval system