KEGG   Thermoanaerobacterium thermosaccharolyticum DSM 571: Tthe_2646Help
Entry
Tthe_2646         CDS       T01299                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ttm  Thermoanaerobacterium thermosaccharolyticum DSM 571
Pathway
ttm00010  Glycolysis / Gluconeogenesis
ttm00071  Fatty acid degradation
ttm00350  Tyrosine metabolism
ttm00620  Pyruvate metabolism
ttm00625  Chloroalkane and chloroalkene degradation
ttm00626  Naphthalene degradation
ttm00650  Butanoate metabolism
ttm01100  Metabolic pathways
ttm01110  Biosynthesis of secondary metabolites
ttm01120  Microbial metabolism in diverse environments
ttm01130  Biosynthesis of antibiotics
ttm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ttm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tthe_2646
   00620 Pyruvate metabolism
    Tthe_2646
   00650 Butanoate metabolism
    Tthe_2646
  Lipid metabolism
   00071 Fatty acid degradation
    Tthe_2646
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tthe_2646
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tthe_2646
   00626 Naphthalene degradation
    Tthe_2646
Enzymes [BR:ttm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tthe_2646
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tthe_2646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 GP57
Motif
Other DBs
NCBI-ProteinID: ADL70096
JGI: Tthe_2646
UniProt: D9TMP1
Position
2671939..2674518
Genome map
AA seq 859 aa AA seqDB search
MATAKMETDVQKQIDLLVSKAQEAQKKFMSYTQEQIDAIVKAMALAGVDKHVELAKLAYE
ETKMGVYEDKITKNLFATEYVYHDIKNEKTVGIINENIEENYMEVAEPIGVIAGVTPVTN
PTSTTMFKCLISIKTRNPIIFSFHPKAIKCSIAAAKVMYEAALKAGAPEGCIGWIETPSI
EATQLLMTHPGVSLILATGGAGMVKSAYSSGKPALGVGPGNVPCYIEKSANIKRAVSDLI
LSKTFDNGVICASEQAVIIDEEIADEVKKLMKEYGCYFLNKDEIKKLEKFAIDEQSCAMS
PAVVGQPATKIAEMADFKVPDGTKILVAEYEGIGPKYPLSREKLSPILACYTVKDYNEGI
KKCEEMTEFGGLGHSAVIHSENQDVINEFARRVRTGRLIVNSPSSQGAIGDIYNTNTPSL
TLGCGSMGRNSTTDNVSVNNLLNIKRVVIRKDRMKWFKIPPKIYFESGSLQYLCKVKKKK
AFIVTDPFMVKLGFVDKVTYQLDKANIDYEIFSEVEPDPSVDTVMNGVKIMNSYNPDLII
AVGGGSAIDAAKGMWLFYEYPDTEFETLRLKFADIRKRAFKFPELGKKALFIAIPTTSGT
GSEVTAFAVITDKKRNIKYPLADYELTPDIAIIDPDLTKTVPPSVTADTGMDVLTHAIEA
YVSVMASDYTDALAEKAIKLVFEYLPKAYKNGNDEVAREKMHNASCMAGMAFTNAFLGIN
HSMAHILGGKFHIPHGRANAILLPYVIKYNAEKPTKFVAYPQYEYPKAAERYAEIARFLG
LPASTVEEGVESLIEAIKNLMKELNIPLTLKDAGINKEQFEKEIDEMSDIAFNDQCTGSN
PRMPLTKEIAEIYRKAYGA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcaaaaatggaaacggacgttcaaaagcaaatagatttacttgtatcaaaa
gctcaagaagcccagaagaaattcatgtcctatacacaggagcaaatagacgcaatagta
aaggcaatggccttagcaggcgtagataaacacgtggaactggcaaagctagcatatgaa
gagacaaaaatgggcgtatatgaagataagattacaaaaaatctctttgcaacagagtac
gtatatcacgatataaaaaatgaaaaaactgtaggcataattaatgaaaacatagaagaa
aattacatggaagtagcagagccaataggagtcattgcaggtgtcacacctgttacaaac
ccaacatccacaacaatgtttaaatgcttaatatccataaagacaagaaatcctataata
ttcagctttcatccaaaggctataaaatgcagcatagcggctgctaaagtaatgtatgaa
gctgcattaaaggcaggtgcacctgaaggttgtataggctggatagaaacaccgtcaatt
gaagcgacacagcttctcatgacacatccaggtgtctcattaatccttgccacaggcggc
gcaggaatggttaaatcagcatacagctcaggcaaaccagcattaggcgtaggtcctggc
aatgttccgtgctacattgagaaatcagcaaacataaagagagctgtatcagacctcatc
ttaagtaagacatttgataacggagtaatatgcgcatcagagcaagctgtaataatagac
gaagaaatagcagatgaagtaaagaagcttatgaaggagtacggctgctacttcttaaat
aaagacgagataaagaaacttgaaaaatttgcaattgatgagcagagctgcgcaatgagc
cctgcagtcgtaggtcaaccggcaacaaagattgctgaaatggcagattttaaagtccct
gacggcacaaagatattagttgcagaatacgaaggtataggtccaaagtatccgctgtca
agagagaaattaagccctatacttgcttgctacactgttaaagactacaacgaaggaatc
aaaaagtgcgaggaaatgactgaatttggaggtttaggacactccgctgtaatacactct
gaaaatcaagacgtaataaacgaatttgcaagaagagtccgcacaggaagacttatcgta
aattcaccatcatcgcagggagcaataggagatatatacaatacaaacacgccatcactt
acattgggctgcggttctatgggaagaaactcaacaacagacaacgtaagtgtcaataac
cttttaaatattaagcgtgttgtgataaggaaggatagaatgaaatggttcaagattcca
ccaaagatttactttgaaagcgggtcactgcagtatctgtgcaaagtaaagaagaaaaaa
gcctttatcgtcacagatccattcatggtaaagcttggctttgtagacaaagtgacatat
cagttagataaggcaaatatcgactacgaaatattctcagaagttgagccagacccatct
gttgatacagttatgaacggcgtaaaaatcatgaattcatacaatcctgatctgataata
gctgtaggcggcggatctgcaatagacgcagctaaaggaatgtggcttttctacgaatat
cctgatactgagtttgaaacgctgaggcttaaatttgcagacatcagaaagagagcattt
aagttcccagagcttggcaaaaaagcattattcatagcaatacctacaacaagcggcaca
ggctcagaagtcaccgcattcgctgtaataacggacaaaaagagaaatatcaaatatcca
ctggcagactatgaattaacacctgatatagcgataatagatcctgaccttacaaagaca
gttccaccgtctgtaacagcagatacaggtatggacgtcctgacacacgctatagaagca
tatgtgtctgttatggcttcagattatacagatgcactggcagaaaaagcgataaagctc
gtatttgaatacctgccaaaagcatacaaaaacggcaatgatgaagtagcccgtgaaaag
atgcataatgcttcctgcatggctggtatggcatttacaaatgcattcttaggaataaac
cacagtatggcacacatactaggcggtaagttccacataccacacggaagagccaatgct
atacttctcccatacgtcatcaaatacaatgcagaaaagcctacaaagtttgtagcatat
ccgcaatacgaatatccaaaggcagcagaaagatatgctgaaatcgccagattcttagga
ctgcctgcatcaaccgttgaagaaggcgtagaaagcttaattgaagctataaagaatctc
atgaaagagcttaatattccactgactcttaaggacgccggcatcaataaagaacaattc
gagaaggaaattgacgagatgtcagacatcgcatttaatgaccagtgcacaggctcaaat
ccgagaatgcctcttacaaaagaaatcgcagagatctacagaaaagcatacggtgcataa

DBGET integrated database retrieval system