KEGG   Thermoproteus tenax: TTX_0060Help
Entry
TTX_0060          CDS       T01641                                 

Gene name
hxk
Definition
(GenBank) ATP-dependent hexokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00010  Glycolysis / Gluconeogenesis
ttn00052  Galactose metabolism
ttn00500  Starch and sucrose metabolism
ttn00520  Amino sugar and nucleotide sugar metabolism
ttn00521  Streptomycin biosynthesis
ttn01100  Metabolic pathways
ttn01110  Biosynthesis of secondary metabolites
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
ttn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_0060 (hxk)
   00052 Galactose metabolism
    TTX_0060 (hxk)
   00500 Starch and sucrose metabolism
    TTX_0060 (hxk)
   00520 Amino sugar and nucleotide sugar metabolism
    TTX_0060 (hxk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TTX_0060 (hxk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TTX_0060 (hxk)
Enzymes [BR:ttn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TTX_0060 (hxk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: CCC80737
UniProt: G4RMA6
Position
59001..59906
Genome map
AA seq 301 aa AA seqDB search
MILAIDVGATWTRVLLVSRDGRVERREKFRTDESPVEKAARLVEGWEFEAIGVGSIGPMD
LRRGWVTASPNSPSKSFPLVEPLLKFKRPVYVANDCVAAAWGEYVLGGWGVDNLAYLTLS
TGLGVGAVVNGHLILGKEGNAHELGHAVLDVRGDVKCGCGGLGHWEAMAGGANIPSYFRV
FAARLGLRAPEVRTAEDVFKLYREGDRVAQMFVDHWVDVNAAGIATITAAYDPEVLVVGG
SIALNHWDLVEAAVDRLKKYTPLTPPALEKAKFGDDEVAMGAAALAIRPPDTLKKFGYPR
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatcttggccatcgacgtaggcgccacttggactagagtccttctggtgagcagagat
gggcgagtggagaggagggagaagttccgaaccgacgagagcccggttgagaaggcagcg
agactggtcgagggctgggagttcgaggccatcggcgtgggctccatcgggcccatggac
ctcaggaggggctgggttactgcgtctcccaattcgccctcaaagagctttcccctggtt
gagcctttgcttaagttcaagaggccggtctacgtggccaacgactgcgttgccgccgcc
tggggcgagtatgtgctgggcggctggggcgtagacaacctggcgtatctgactctttcc
acaggcttgggcgtaggagcagtggtgaacggccatctgatcttgggcaaggagggcaac
gcccacgagttgggccacgccgtgttggacgttaggggggacgtaaaatgcggctgcggc
ggcttgggccactgggaggctatggctggcggggccaatatacctagctatttcagagtg
ttcgccgctaggttgggcctcagggcgcccgaggttagaacggcggaagatgtattcaag
ctgtacagagagggggaccgtgtggctcagatgttcgtagaccactgggtggacgtaaac
gccgccggcatcgccacgataactgcggcctacgaccccgaggttctcgtggtgggcggg
tctatagctctaaatcattgggatctggtggaggccgcggtcgaccgtcttaagaagtat
actcctctgacgccgccggcgctggagaaggcaaagttcggcgacgacgaggtggcgatg
ggcgcagccgccctcgccataaggccgccggatactctgaagaagttcgggtatcccaga
ttctga

DBGET integrated database retrieval system