KEGG   Thermoproteus tenax: TTX_0060Help
Entry
TTX_0060          CDS       T01641                                 

Gene name
hxk
Definition
ATP-dependent hexokinase (EC:2.7.1.1)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ttn  Thermoproteus tenax
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTX_0060 (hxk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_0060 (hxk)
   00052 Galactose metabolism
    TTX_0060 (hxk)
   00500 Starch and sucrose metabolism
    TTX_0060 (hxk)
   00520 Amino sugar and nucleotide sugar metabolism
    TTX_0060 (hxk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TTX_0060 (hxk)
   00524 Butirosin and neomycin biosynthesis
    TTX_0060 (hxk)
Enzymes [BR:ttn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TTX_0060 (hxk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59001..59906
Genome map
AA seq 301 aa AA seqDB search
MILAIDVGATWTRVLLVSRDGRVERREKFRTDESPVEKAARLVEGWEFEAIGVGSIGPMD
LRRGWVTASPNSPSKSFPLVEPLLKFKRPVYVANDCVAAAWGEYVLGGWGVDNLAYLTLS
TGLGVGAVVNGHLILGKEGNAHELGHAVLDVRGDVKCGCGGLGHWEAMAGGANIPSYFRV
FAARLGLRAPEVRTAEDVFKLYREGDRVAQMFVDHWVDVNAAGIATITAAYDPEVLVVGG
SIALNHWDLVEAAVDRLKKYTPLTPPALEKAKFGDDEVAMGAAALAIRPPDTLKKFGYPR
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatcttggccatcgacgtaggcgccacttggactagagtccttctggtgagcagagat
gggcgagtggagaggagggagaagttccgaaccgacgagagcccggttgagaaggcagcg
agactggtcgagggctgggagttcgaggccatcggcgtgggctccatcgggcccatggac
ctcaggaggggctgggttactgcgtctcccaattcgccctcaaagagctttcccctggtt
gagcctttgcttaagttcaagaggccggtctacgtggccaacgactgcgttgccgccgcc
tggggcgagtatgtgctgggcggctggggcgtagacaacctggcgtatctgactctttcc
acaggcttgggcgtaggagcagtggtgaacggccatctgatcttgggcaaggagggcaac
gcccacgagttgggccacgccgtgttggacgttaggggggacgtaaaatgcggctgcggc
ggcttgggccactgggaggctatggctggcggggccaatatacctagctatttcagagtg
ttcgccgctaggttgggcctcagggcgcccgaggttagaacggcggaagatgtattcaag
ctgtacagagagggggaccgtgtggctcagatgttcgtagaccactgggtggacgtaaac
gccgccggcatcgccacgataactgcggcctacgaccccgaggttctcgtggtgggcggg
tctatagctctaaatcattgggatctggtggaggccgcggtcgaccgtcttaagaagtat
actcctctgacgccgccggcgctggagaaggcaaagttcggcgacgacgaggtggcgatg
ggcgcagccgccctcgccataaggccgccggatactctgaagaagttcgggtatcccaga
ttctga

DBGET integrated database retrieval system