KEGG   Thermoproteus tenax: TTX_0184Help
Entry
TTX_0184          CDS       T01641                                 

Gene name
fucA
Definition
fuculose-1-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ttn  Thermoproteus tenax
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TTX_0184 (fucA)
Enzymes [BR:ttn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TTX_0184 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170623..171183
Genome map
AA seq 186 aa AA seqDB search
MIEEEIVEYYKLLYLRGLSTLLSGNISVRSGDLILITPTSLPKPLLRPEDLVYIDFEGRV
VKGTRQPSSEWRMHAAVYRRRPDVGAIVHVHPVHSTLLAERIKPDLFLEGDIYIGGPLAV
VPPLQPGTWELAEAVADALARANVAVLKKHGVVAVGRSLAEAVNRVEVVEDLAKATLINL
WINSGI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaggaggagatcgtagaatattacaagctcctctacttgagaggactctcaact
ctcctcagcggcaacataagcgttaggtcgggcgacctcatcctcataactcccaccagc
ctcccaaagcccctcttgaggccggaggacttagtctatatagatttcgaggggcgagta
gtgaaggggaccagacagccctcctccgagtggaggatgcatgcggcggtctataggagg
aggcctgacgtaggcgccatagtacacgtccacccagtccattctactctgcttgctgag
aggataaagccggacctattcctcgagggagatatatatatcggcggccctctggcggtt
gtcccgccgcttcagcccggcacttgggagctggccgaggcggtggccgacgctctagcc
agagccaacgtcgccgtgcttaaaaaacacggcgttgtcgcagtggggaggagcttggcg
gaggccgtcaatagagttgaggtcgtggaggatctggccaaggccactctgatcaaccta
tggataaacagcggcatctga

DBGET integrated database retrieval system