KEGG   Thermoproteus tenax: TTX_0208Help
Entry
TTX_0208          CDS       T01641                                 

Gene name
oorCD
Definition
(GenBank) 2-oxoacid ferredoxin oxidoreductase, gamma-delta subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ttn  Thermoproteus tenax
Pathway
ttn00010  Glycolysis / Gluconeogenesis
ttn00020  Citrate cycle (TCA cycle)
ttn00620  Pyruvate metabolism
ttn00633  Nitrotoluene degradation
ttn00640  Propanoate metabolism
ttn00650  Butanoate metabolism
ttn00680  Methane metabolism
ttn00720  Carbon fixation pathways in prokaryotes
ttn01100  Metabolic pathways
ttn01120  Microbial metabolism in diverse environments
ttn01130  Biosynthesis of antibiotics
ttn01200  Carbon metabolism
Module
ttn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
ttn_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTX_0208 (oorCD)
   00020 Citrate cycle (TCA cycle)
    TTX_0208 (oorCD)
   00620 Pyruvate metabolism
    TTX_0208 (oorCD)
   00640 Propanoate metabolism
    TTX_0208 (oorCD)
   00650 Butanoate metabolism
    TTX_0208 (oorCD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_0208 (oorCD)
   00680 Methane metabolism
    TTX_0208 (oorCD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TTX_0208 (oorCD)
Enzymes [BR:ttn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TTX_0208 (oorCD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_21 Fer4_7 Fer4_6 Fer4_16 Fer4_9 Fer4_10 Fer4_2 Fer4_8 Fer4_17 Fer4_4 Fer4_13 DUF2073
Motif
Other DBs
NCBI-ProteinID: CCC80887
UniProt: G4RMU3
Position
196573..197508
Genome map
AA seq 311 aa AA seqDB search
MRIDTVWIGRGGQGIVTAVYIVAHASIADGFYALANPEFGAERRGAPVKAFLRISDTFED
APEPIKTPDVAVILDDKLIDPMRVVIDAVKPGGYVLVSSGKDPEKVAELIGRKDVNIAVV
DGIGIALKHVKLAVPNGPMVGVFARVMGFPKLQSIKEAIESQLGKAVEQNFAAAEEAYKT
AVIIPATEQGTAKAAVEIPTTSAFLTGDYELVGWDKIPEGGLTYPGSSLRYKTGSWRVEK
PIIDHSKCIMCRKCWMFCPDDAVLEVWRETKLPSGRVVRVKAIDFSYEYCKGCGICADVC
PTGAIQMVREI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaatagatacggtgtggatagggagagggggacaggggatagtcaccgccgtctat
atcgtggcccacgcctctattgctgacggcttttacgcgttggctaatccagagtttggg
gcagagaggaggggggccccagtgaaggcctttctgaggatatccgacacgttcgaggac
gccccggagcccataaagacccccgatgtggccgtgatattggacgataaactgatcgac
cccatgagggtagtcatcgatgccgtgaagcccgggggctacgtcctagtcagctccggc
aaagaccccgagaaggtggccgagctgatcgggagaaaggacgtgaacatagccgtagtg
gacgggataggcatagccctgaaacacgtgaaattggcggtgcccaacgggcctatggtc
ggcgtattcgcaagagttatgggcttccccaagcttcagtcgatcaaggaggcgatagag
tcccaattgggcaaagccgtggagcagaacttcgccgcggctgaggaggcctacaagacg
gcggtgataataccggccactgagcagggcacagccaaggccgctgtggagatccccacg
acctccgccttcttgaccggcgactacgagctggtggggtgggacaagatacctgagggc
ggtttgacctacccgggaagcagcctgcgctataagaccggctcttggcgtgtggagaag
cccatcatagaccactccaagtgtatcatgtgcagaaaatgttggatgttctgtcccgac
gacgccgtgctggaggtatggcgcgagaccaagctgccgagcggcagagtggtcagagta
aaggccatagacttcagctacgagtactgcaagggctgcggcatatgtgccgacgtgtgc
cccactggggcaatacagatggttagagagatatga

DBGET integrated database retrieval system